Z5gpifGvG2FiVptCfvTj/9oomDxZDi5nOAANkvQXo/tDHCMhzNh0-yAzmM5f6A/fLKgMVonGEWGIAmBpDPF hCO/lib64/ld-linux-x86-64.so.2 AUATUSH []A\A] ATUSH []A\ ATUSH []A\ t$(H T$0H L$8L D$@L )D$P )L$` )T$p =A}[ AWAVI []A\A]A^A_ P[]A\ []A\A] []A\A] \$PH []A\ AVAUATI I D$ []A\A]A^A_ ([]A\A] SUATAUAVAWH A_A^A]A\][ v,UH |$XL T$xH T$`L L$hE t$OL d$pH L$pf |$hL \$EH9 L$pH |$hH t$xH9 t$XH9 |$`L \$;H9 L$PH T$xH D$PH L$xH9 |$`I wDH) |$ @ t$(D t$(D l$ M9,$u v+UH M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u v,UH D$ H D$ H 8cpu.u D$PH t$pH L$HH \$`H) \$ M \$XH onuzH ofu]F fuQH T$@1 D$XH D$`H t$pL L$(H D$hf D$hH t$pL L$PH D$xH L$pH D$pH D$xH |$8H D$0L T$@H \$`H t$pH |$8L D$PL L$HD t$pL D$`H t$pL D$HH D$HH L$CH \$C! \$B! vIUH H9S( P0H9S0 P98S9 H9PH PPH9SP PY8SY H9Ph PpH9Sp Py8Sy D$0H \$81 D$0H \$8H t$0H |$8H UUUUUUUUH! 33333333H! oO f oO0f D$ L w2fE 7fD9 w@fA 7fD9 D$ H D$(I D$ I D$ L D$0H \$8H |$HE D$PH D$(H L$8E D$@H D$XH \$`H |$pH L$@H D$`H T$XH T$pH9 \$0H t$(H D$81 T$(H9 L$ H D$0H T$ H T$ H t$8L L$@H |$ f D$0H \$8H L$@H |$HH T$0H L$@H \$8H |$HH D$0H \$8H D$0H L$@H \$8H L$0H \$8H |$@H \$8H |$@H \$PH |$`H t$ L D$0A D$(H \$PH t$ H T$PH D$(H v6UH \$0H T$0H L$@H D$PH \$XH D$PH L$`H \$XH D$(H D$(H L$PH \$XH |$`H D$8H D$8H D$(H D$(H L$PH \$XH t$`H D$0H D$0H D$hH \$pH t$HH t$ L D$hH \$pH t$ L T$0M D$HA D$@H \$@H T$pH \$0H T$HH t$0L T$PL D$(H T$PH T$PH t$(H \$pH T$pH |$0H t$HA t$8H L$8H |$0H L$hH vWUH D$ H D$`H \$hH D$0H T$`H t$@1 |$hL L$(L \$HL T$8H \$hH |$8H t$HH D$0H L$(H L$0H L$0I T$`H B!@H D$8H \$@H D$8H L$HH \$@H \$@H t$HH \$@H |$HH L$8H L$8H D$HH \$PH |$`H t$0H D$HH \$PH |$`H t$0H t$ A D$(H L$HH T$ H L$PH T$ H D$8H |$PH D$8H |$PH \$ H T$ H D$8H \$@H |$PH D$8H \$@H |$PH t$ H \$ H T$ H D$8H \$@H |$PH D$8H \$@H |$PH \$ H |$ H |$ 1 }b@8 T$0H L$8H t$(H L$8H T$0H t$(H \$PL L$XL \$PL d$@L T$HM d$@M9 T$8H D$8H D$XH \$`H t$xH |$pH T$@H L$ fH D$@I9p T$(L L$0L D$8I D$XH L$ H T$(H \$`H t$xH L$xH T$8H L$pI L$`H T$0H T$@H D$XH \$`H t$xH |$pL D$@I \$@H |$ H |$ H D$0H \$8H L$@@ |$HH L$@H L$8H \$0H D$(H \$0f T$(H L$8f 4qf9 D$01 D$XH \$`H L$hH |$pH t$(I L$@M D$@M D$ M D$XH \$`H t$(H |$pL T$hf D$ L d$0M L$@A L$8H T$`H |$0H D$8H D$8I T$(H |$ L T$xL \$HL d$pM $$fI d$pM <$fI d$0M T$(H |$ L D$8L T$xL \$HL d$0L L$PL |$pA |$hH \$hH t$PH \$@H T$`H T$`H |$@H t$pA t$XH L$XH |$@H |$ H t$(f |$ H t$(f T$(M D$@L D$ H \$HH t$`H D$@H \$HH t$`L D$ L D$@L D$ L D$(A |$ H |$ H D$`H \$hH L$pH |$xH D$(I T$HM L$HM L$ M D$`H L$pH \$hH D$(L \$xM L$ L l$0M T$HL T$8A d$@H T$pH t$8H L$`H T$hH t$0H L$`H t$0H D$HH |$ H |$ H D$ H L$0H L$ H L$ H D$(H \$0H L$8H t$(H I9x(u D$0H T$(H D$8L D$0H D$PH pXH9 L$0H D$PH L$0H pXH9 \$0H xXH) xXH9 T$(L T$(H D$PH D$PH T$(L HXL) T$ L L$8L t$PH I9x(t D$8H T$ H t$PH v0UH |$/H D$PH T$0H L$@M L$`1 L$PH L$`E \$8M d$hL \$XI L$0H L$HH t$PH |$XH t$hH D$HH L$@H T$0H \$8H D$hH \$pH T$hf D$8H t$p1 L$0H |$H1 |$HD \$(L \$PL T$@H t$xH \$pH |$@H t$PH D$8H L$0H T$hH \$(H D$(H L$0H |$(L D$(H L$0H |$(L D$`H L$pH L$$H D$0H D$0H L$hH D$0H T$pH |$pH D$HH D$HH L$hH t$pH \$`H D$(fI d$@M <$fI D$(L l$0M L$(G T$8H L$hH v6UH L$8H L$8H D$(H \$0H L$8H L$0H |$(L D$(H \$0H L$8H L$0H |$(L D$`H \$hH D$`H L$pH \$hH L$(H D$0H D$0H L$hH D$0H L$hH T$pH \$`H |$pH D$HH D$HH L$hH T$0H t$pH \$`H D$ fI d$@M <$fI D$ L l$0M |$@H L$ G T$8H L$hH D$`H \$hH D$`H L$pH \$hH L$8H D$(H D$(H L$hH D$(H L$hH T$pH \$`H |$pH D$HH D$HH L$hH T$(H t$pH \$`H D$ fI d$@M <$fI D$ L l$(M L$ G T$0H L$hH v7UH L$8H L$8H L$XH |$`H D$@H T$PH t$8H L$(H D$ L L$hI |$hH \$hM9K |$0L \$HI D$ H L$(H T$PH t$8H |$0L T$@f D$HH L$XH |$`H D$@H T$PH t$8H L$(H D$ L L$hI |$hH \$hM9K |$0L \$HI D$ H L$(H T$PH t$8H |$0L D$HH D$PH D$PH D$PH T$PH T$pH t$HH D$8H D$0L T$XL |$(fH |$(M \$@H |$`L |$hI D$0H T$pH t$HL D$8L T$XL \$@L d$PL T$hH t$`H D$(F T$xH vH9 w9H9V D$PH L$`H \$XH t$pH |$hH T$0H L$0L) D$PH L$`H \$XH t$pH |$hH \$PH L$8H t$hH D$PH L$`H \$XH t$pH |$hH D$PH L$`H \$XH t$pH |$hH |$ H |$ H vEUH D$HH o4M9 t$hL D$HH \$PL \$0f L$PH L$HH |$ H t$(L |$ H t$(L D$pH \$xH D$pH D$ H L$HH L$@H L$XH D$XH D$ H D$(1 T$0H D$pH L$0H9 D$(H T$01 T$PH t$@1 D$8H |$HL D$0L t$HH T$0H D$8H T$PH t$@f vnUH %j5Y D$PH D$PH L$PH T$0H |$ H t$(D |$ H t$(D L$8H |$ H9 D$xH D$xH+ xXH) D$0H D$@H D$xH L$`H L$XH L$PH L$(H L$ H D$(H L$HH L$ H D$xH L$`H L$XH) D$XH \$`H D$XH \$`H L$(H D$XH \$`H t$(H D$0H |$0H \$(H \$(H D$@H \$ H \$ H D$8H L$@1 D$@H \$(H vfUH D$0H L$@H D$0H D$0H vfUH D$ H T$ H RXH9 vVH) L$@H D$(H T$ H |>Hc YA H v\UH 8ofu 8ofu \$0H D$0Hc D$(H L$(H jHAH MbP?H v`UH \$0H9K veUH D$pH9H L$xf L$HH L$pH D$pH L$8H T$HH L$8H) D$pH D$@H L$pH D$PH D$pH MbP?H v+UH D$0H9H D$0H L$0H v H9 vpUH D$ H D$ H D$XH \$`H L$h@ |$pH D$XH |$pH9\$ L$ H L$XH L$(H D$0H \$8H D$`H D$@H T$hH v7UH T$ H+: T$ H D$8H D$ H D$8H D$@H D$ H |$8H L$hH L$0H |$8H T$hH T$0H \$ L t$`J D$@H \$(H t$hH t$HH t$ H |$`H \$HH D$HH \$(H \$XH \$PH \$hH9 t$HH L$(H t$hH t$ H t$`H \$HH T$ H t$`H \$@H D$hH UUUUUUUUH! UUUUUUUUH wwwwwwwwH! wwwwwwwwH u+H @uFH L$`H D$PH L$8H \$ H D$PH T$`H L$8H \$ H D$ H D$PH L$8H T$`H T$ H L$(H T$0H T$0I L$(H L$PH T$0H L$(H D$8I9 vDH95( v7UH |$0L D$(D D$(L \$0I9 d$ M |$8A \$8A D$ fD D9L$ L$0H D$8H \$@H t$ @ T$8H D$@H9 t$$H D$8H \$@H L$HH |$PH t$ D T$8H D$@H9 |$$L D$HL L$PO w/9H \$0f w%9H \$0f \$0H \$0H \$0H D$PD T$(H T$8H T$01 t$ H D$PH T$8H t$ H L$PH D$(H \$0H L$8H L$(H L$8H \$0H D$(H ?u9H L$(H L$0H ?s0H L$`H L$(H t$ H >u H L$`H t$8H) T$(H |$0H D$ H D$(H L$ H t$0H D$HH L$ H vcUH t$8I L$8H L$0H D$(1 L$0H L$8H D$0H D$ H D9BX T$@D t$ D D$$H t$ D D$$H \$8L t$ H D$$L \$8H f9J2vnH L$HH t$ D D$$L L$HD \$8I L$(1 |$pH9 D$PL L$(H t$ H |$pD D$$D \$8D L$@H L$@H t$$9 \$@H t$pf f9s2uFf u@H= \$8H L$@H D$@H L$XH L$XH t$ D D$$D z2H9 z0H9 D$`H L$0H t$ D D$$D \$8H D$`H L$0H t$ D D$$D T$@H L$8H t$hH t$ H D$$L T$hI t$ H D$$L T$hL D$ H D$0H D$0H \$(H D$0H D$ H D$ H D$0H D$0H \$(H D$0H D$ H vzUH D$hH L$ H P2H9 L$ H D$(H L$HH D$@H D$@H \$HH T$ H D$@H D$@H \$HH \$HH t$@H v4UH D$(H \$0H L$(H \$0H L$(H \$01 \$`H D$XH |$pH L$hH L$XH L$hH \$`H |$p1 L$8H \$@H T$ L L$(@ D$XH L$8H T$ H |$0L L$XH L$8H \$@H D$0H L$0H L$0H D$8H D$@H D$8H D$(H T$(H L$ H D$0H v5UH v7UH v7UH vnUH L$0H D$(H \$ H D$(H T$0H D$HH \$PH |$(H D$ H t$HH L$(H |$0H D$ H9 t$HH |$(L D$0L L$ H t$HH \$PH t H9A H9Ap H9Apw D$8H D$8H D$8H D$8H D$8H D$8H D$8H D$8H T$XI t$PH T$XH L$8L T$hH |$@1 v6I9 \$0@ L$8H |$@L T$hL d$HL L$8H |$@M T$hI T$XH D$$u$L T$xL l$pH t$PL d$hL D$@H \$`E1 L$$H \$(H T$8H) \$(H D$8H T$xM9 L$HE1 l$pI L$XH D$01 L$XH D$@L L$HI \$`L d$hL |$ H t$(L |$ H t$(L vmUH |$(H \$ H L$0H vdUH D$(H \$ @ D$(H T$0H v+UH D$0H D$0H D$8L L$xH L$`H D$`H D$PH L$PH \$8H D$`H L$PH T$xH L$PL L$xH D$`H \$8H \$8H D$`L T$/L D$0H \$XH L$@H L$@H T$0H) D$`L L$xL \$HH T$8H D$`H T$8H \$HH) L$8H D$xH D$8H L$H@ |$IH t$PL D$XH D$8H \$PH D$XH D$HH L$@H |$@H T$@H t$ L t$ L r L9 \$@H t$xH T$`H \$HH |$8H D$xH T$`H \$HH t$xH D$8H D$@L D$XH D$ H L$XH t$xH D$0H D$(H T$PH D$xH \$(H T$PH t$0H D$0H L$@H D$0H \$8H L$@H D$0H D$XH \$(H \$(H L$(H L$(H L$(H L$(H D$XH L$`H L$@H T$`H D$XH T$`H D$0H D$8H \$@H L$ H L$ H \$@H D$HH L$XH L$0I L$HH L$ H u @8w t$X@ t$XH |$PH \$PH L$0I L$HH u @8w D$PH \$XH L$`H |$hH T$XH t$hH T$XI t$hI |$pI T$`H D$P1 D$P1 t$(H \$0H D$8H T$(D T$8H |$ H |$ H vpUH t$(I vHUH D$0H T$PH D$8H T$(H T$(D D$0H T$8H D$Pf D$HH L$(I L$HH D$0H D$0H L$8H D$01 T$8H T$8H D$8I D$8I T$8H |$0H \$0H t$(1 T$(H t$0H |$(1 T$(H D$ H \$8@ D$0H L$@H D$0H T$8I \$HH T$0H t$H@ T$hH L$0H \$(H D$hH \$(H |$XI \$0I |$PI T$HL9 T$XH9 \$(H \$(H T$HH T$81 T$HH |$8H \$(H9 |$ H t$@H D$`H t$ H |$(D |$0D |$@H L$HH L$hH t$ H T$PH L$hH T$PH t$ I t$0L L$8J L$8H O`I) L$8H T$(J L$(H9 D$PL |$HL D$`1 |$HH L$PL D$`H |$@L L$xL D$PM9 L$'H l$XM d$xI T$pL) T$pH D$XI9 L$8H T$hJ L$hH T$0H9 |$ @ t$!f |$hI T$`H L$XH t$PH L$HI L$@H \$8J D$0H T$8H t$xH \$`H \$hH T$hH t$PH L$@J t$8H D$0H T$8H t$xH \$`H \$hH D$0H D$ H D$ H T$ H \$(H T$pD T$PH |$ L D$(H D$ L D$ H9 T$(H T$8H D$p1 T$ H t$8H |$xH D$XH L$HH L$@H D$8H D$0H T$xH t$8H \$PH T$0H t$ H t$pL t$hL |$xL \$ H L$`H T$`O L$hH t$hL t$hL L$hH |$xL ?s A \$PH |$Xs t$0f L$8H \$@H L$ H D$ H D$HH @hI9 t$0L T$0H L$PH T$HH t$0H T$ H D$HH T$HH D$ L D$0H D$HH D$0% D$`I T$XH L$PH t$HH L$@I L$(H T$hH D$hH \$`H L$XH T$`H t$hH T$hL) L$0H D$hH \$`H L$XH D$hH t$HL D$8H D$HH T$8L9 D$PH L$@H L$ H D$hH \$H1 D$(H D$pH D$P1 L$(H T$0H T$0H T$ H |$(L D$01 L$(H L$(H t$xH d$0M T$`H T$`H t$xI d$0I D$(H d$8H L$XM \$8O T$Xf t$xI d$0I D$(K T$PL \$HL l$@I9 L$ L T$HH t$PH9 L$@H D$ H D$ H L$HH T$PH9 T$@H t$ H) D$xH D$(H t$xI D$xH T$xH D$xH L$`H L$XL D$(L T$ H T$0J D$PH \$HH L$ H T$0H L$(H L$PH T$PH L$HH t$@H9 D$8H T$HH t$PH9 L$@H D$8H D$8H L$XH T$`H \$ H9 T$xH T$xH \$(H9 L$HH T$PH9 L$HH T$PH9 D$8H vtUH D$81 T$ H |$8H vcUH v(H9 D$(H D$(H D$PH L$0H T$(1 L$ L D$PH L$ H T$(H \$XI L$0L T$8L D$PH L$ H T$(H \$XI L$0L T$PD @hI9 D$hL L$hI t$hH t$@H T$8H T$8H t$PH t$@I \$HO L$hM T$ L D$0H \$@L T$(M D T$01 D$hH \$(H D$@H t$hH \$0H L$ H D$0H D$0H D$@H |$(H t$ L t$ H |$(I D$@H t$ H |$(L tSH9 vlUH @rWI @s.L vUH H9X u D$`H L$`H T$XH T$ H L$(L L$0H L$8H D$HH L$`H |$0H D$01 D$0H D$hL L$PL \$@H \$HL T$8H \$HH L$XH D$HH \$PL D$pL T$pH L$PH \$HH9 L$PH \$HH |$ H t$(L |$ H t$(L vEUH D$8H \$@H L$HH T$8H T$ H D$xH T$`H t$xH D$HH t$ H t$(H t$0H t$8H \$@H t$HH D$XH D$XH T$`H T$`H |$ H t$(L D$0L L$8f |$ H t$(L D$0L D$fE d$7L ~}M9 s@fD T$>I d$>fG d$7I t$@M $qI9 s6fD d$>I $ M9 |$ H t$(D |$ H t$(D v+UH v+UH v{UH D$0H L$0H \$8H v%UH \$pH L$xH D$@H L$hH GA@s} T$8H L$@H L$0H T$8H \$@H t$hH |$xI L$0H T$8H \$@H t$hL L$0H T$HH L$PH D$8H L$hH D$@H T$(H) |$ @ GA@s} \$`H L$hL T$ L D$8H D$ H D$(H D$(H \$hH \$hH L$@L L$@H 9q0s&H9J D$8H T$ H D$8H D$8H 9z0w tDH9r tJH9Z DH9Z tJH9Z DH9Z D$0H L$0H L$0H T$@H T$HD |$ D |$01 T$HH T$@H D$HH D$HD |$(1 D$HH As5H D$HH As)H |$ D T$ H L$HH L$@H |$`D D$`H v9UH D$0H \$8H L$8H D$0H D$`H D$hL D$XH |$(D |$0D |$@H D$XH |$XH |$XH T$XH L$0H L$8H L$@H L$HH L$hH L$XH D$ H T$(H D$xH T$xH T$ H sPH9 |$@D |$HH D$@H t$@H \$ H9 D$PL t$`H L$@H T$`H t$PH \$ H |$(D |$0H T$8H t$XH L$(H T$XH t$8H D$xH D$0H \$8H L$@@ |$HH D$0H \$8H \$PH L$XL D$pH t$@D \$PH D$pH t$@H D$pH t$@H D$pH t$@H u H9 L$w D$@H T$XL L$HH t$(L \$8L D$0H T$PH |$ H D$@H L$HH T$PH t$(H |$ L D$0L vJUH \$XH |$hD |$ D |$0H L$(H \$ H t$8H |$0H |$ H |$ H veUH \$hH |$xL |$ D |$0D |$@H L$(H \$ H t$8H |$0L L$HL D$@H |$ H t$(L D$0L |$ H t$(L D$0L v}UH \$xH |$ D |$0D |$@D |$PH L$(H \$ H t$8H |$0L L$HL D$@L \$XL T$PH |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L |$ H L$(H \$ H t$8H T$0L L$HL D$@L \$XL T$PH T$hH T$`H \$ H L$(H |$0H t$8L D$@L L$HL T$PL \$ H L$(H |$0H t$8L D$@L L$HL T$PL D$hH T$PH L$8H D$@H \$ H L$(H T$PH t$81 ~xH9 t$8H T$HL \$0H D$@H L$(H T$HH \$ H t$8L v_UH D$XH L$hH t$xD |$(D |$8H \$ H |$0H L$(L D$@H t$8H |$ H t$(L |$ H t$(L \$8H L$@f L$@H \$8H \$@H |$0H \$HH L$PH T$PH \$HH9 t$ H D$(H D$(H t$ H D$HH \$PH L$X1 D$HH L$XH L$XH \$PH T$(H t$ H D$01 L$XH T$(H t$ L D$0H \$PI9 D$xH T$PH t$0H D$xH t$0H9 D$XH L$`H |$@H \$8H t$HH L$0E1 T$PL \$(L) T$PI T$(L D$0L L$`H \$@H L$HH D$XL \$8H t$HH |$@L L$0L9 |$ f \$@H D$ Hc D$ H D$PH |$0H= \$PH D$ H) D$ H \$PH \$0H T$8H D$(H L$8H |$8H D$XH t$ H \$ H D$(H T$XH D$(H \$ H T$XH T$8H \$@H D$0H L$@H w0I D$(f iu^H \$ H t$0H t$(H T$(H L$ H D$0H D$8H L$@H D$8H L$(H |$XH A H9 \$xH D$`H L$XH L$XH D$pH D$H} T$LH \$PH T$LH \$PD D$H1 D$HH L$XH L$`H L$pH L$xH C H9 S(Hk t$hH T$hH t$GH |$hD |$pD D$hH D$HH L$@H T$`H D$HH T$`H L$XH \$PH T$PH T$xH T$HH \$XH9 D$`H D$`H \$@H T$HLk D$XH D$`H T$HH \$@L D$XI D$`H \$@H L$HH D$XH L$PH 51EC T$XH L$PI \$@H \$HH T$HH t$@H D$XH T$ H v`UH D$ H v[UH qhH9 |$HL S`L) T$hH D$`H L$hH T$`H L$hH T$`H D$PH H9D$XA \$`H L$hH |$XH T$XH |$HH T$4H \$PH \$PH D$4H \$xH \$8H L$XH \$xH x`H) |$hH L$`H D$`H L$hH L$hH \$`H D$XH HcD$4 D$`H L$hH D$`H L$hH H9D$XA \$`H L$hH |$XH |$ @ K@H9 D$ H \$XH D$PH {`H) |$HH L$@H L$`H D$HH L$@H T$`1 |$49 \$4H D$HH L$@H H9D$8A D$`H \$@H L$HH |$8H D$4H v.UH v)UH |$ @ v1UH D$ H |vHc D$HH Hc H L$0H L$0H |$(H L$HH D$(H D$PH D$PH D$PH L$ f D$(H L$0H D$(H v%UH v.UH D$@H L$ H v%UH v5UH vkUH D$@H \$HH \$ H |$ f v%UH D$XH D$XH \$`H L$@L T$XH L$@I D$XH \$`H L$XH T$`H9 L$0H9A 6H9F@ D$(H D$(H t$PL D$0H \$8H L$@H |$HL L$`L D$XH D$0H \$@H \$HH t$XI \$PH \$`H t$8H |$ H t$(L D$0L |$ H t$(L D$0L D$@I T$(H D$(H t$8H D$XH T$8H H9A@ L$(H D$ H |$0H \$ H9 D$0H \$8H D$0H t8H9 D$PH 1I9@@ |$(L D$0H t$8H \$(I9 d$ N t$ H |$8H D$PH D$HH D$HH \$0H9 D$HH \$01 T$HH r$Hc L$(H L$(H T$HH L$(H D$0H D$(H L$(H T$0H H9B@ \$0f P8H) \$hL d$`H |$PL T$(H \$0L D$XL L$8I \$0H |$PL D$XL L$8L T$(L \$hL D$`H L$`H \$HH D$hA L$hH t$(H9q8H |$PL D$8H \$XH L$(H D$`H D$`H D$`H t$@H D$`H D$`H ~,H9 vLUH D$(H D$(H D$ H \$(H D$@H T$@L D$7H \$hH L$`H T$@H \$8H D$pH D$pH D$pH L$xH T$P1 D$HH L$xH T$PH9 D$HH D$pH \$8I D$7H \$hH L$`H L$(H T$ H T$(H vSUH vEUH D$HH \$8H D$ 1 T$8H D$HH T$@H |$HD |$PD |$`H \$HH D$xH D$HH D$xH T$@H D$pH D$pH T$@H \$HH t$0I D$(H t$@H t$@H \$0H T$@H D$hH L$0H T$PH t$HH L$0H T$HH T$PH D$hH L$(H T$PH t$@H L$(H T$@H T$PH D$hH L$ H T$PH t$8H L$ H T$8H T$PH D$hH D$@H D$(H D$HH D$'H D$PH D$@H D$(H \$0H L$8H vYUH go 1.23 H trace D$ 1 D$(1 D$(H T$(H L$(I vKUH vFUH D$ H L$ H L$ H L$ H D$XH D$XH \$`H D$@H D$XH D$81 D$XH vIUH L$0H veUH L$ H R E1 \$0H D$XH t$P1 L$HH |$8H D$XH L$HH \$0H D$XH L$HH \$0H L$xH D$pH P2H9 P0H9T$pr L$@H D$XH \$0H D$8H v(UH D$XH T$hH |$0D |$8H t$0H T$8L D$XH T$hH |$0D |$8H t$0H T$8L vWUH D$HH T$XH D$pH D$XH \$8H T$0H T$0H T$HH D$PH D$XH D$pH D$XH \$8H T$0H T$0H T$HH D$PH D$XH vSUH D$HH T$XH+ D$PH L$`H T$`H+ T$0H T$hH D$PH L$`H T$`H+ T$0H T$hH vSUH D$HH T$XH+ z0H9 T$xH L$pD |$ D |$(D |$8D |$HD |$XH T$0H L$HH L$0H L$HH D$ H \$(H T$ L T$xH9T$0u t$pH9t$Hu I9Qxu I9qp D$hH D$0H L$ 1 |$ H t$(D |$ H t$(D D$hL \$pD c0M9 M9c0 \$PL L$hH T$PH \$pL T$8H T$@D L$/H D$hI \$pD L$/H T$@L P8H9P(s L$hH D$0H D$HH D$xH T$PH \$HH T$`H T$xH H9r u z(H9z0 t$`H t$`H t$`H D$xH \$(H T$XH L$@H D$XH D$`H L$x1 t$8H D$`H D$xH L$(H D$ H D$(H L$ H vIUH D$ H L$ H \$8H L$@H \$8H L$@H \$81 |$8H L$(H \$(H |$(H D$0H T$(A |$0H \$8H9 \$8H \$(L T$(H \$'H D$'M9 |$ H |$ H L$pH T$@H \$!H t$HH |$p1 t$HH T$@A D$"D \$0A \$!L \$0D \$!L \$0D T$#H D$$H L$8H \$!H t$HH |$pD D$"D T$#L \$0I D$@H t$#@8 L$"A t$#D t$#D L$"@8 \$8I \$!L \$0D \$!L \$0D D$"1 \$8H D$0H L$8H D$0H \$81 D$PH runtime.H9 gopau/f niu' D$8H L$0H t$(H \$ H D$8H D$0H D$(H D$PH \$(H t$PE1 T$PH L$xH \$HH D$@H D$xH D$0H L$xH9 D$0H D$@H \$HH L$$H D$PH D$$Hc L$xH9 D$xH L$(H) vHUH |$(H \$(H |$ @ |$0H L$hH L$pH D$UH T$(H D$8H L$ H) L$ H L$ H L$8H D$ H D$0H D$0H D$XH T$@H T$0H D$8H D$XH D$`H T$HH t$0L |$8Hc T$8L v6UH vXUH D$hH D$PH |$0H T$0H D$8H D$PH vXUH \$8H D$XH \$@H T$0H T$HH D$PH D$XH v6UH vFUH D$ H D$hH L$xH T$PH D$HH D$@H D$HH L$xH D$XH |$0H T$@H t$0H vkUH D$`H D$HH D$0H D$HH v6UH D$pH D$7L D$hH \$@H D$pH \$HH |$PD |$XH T$PH T$8H T$XH D$`H D$hH L$7H |$ @ \$@I T$`H D$hH \$8H T$@H t$`L |$PH T$PL L$@I T$HH D$hH v6UH D$`H \$HH L$PH t$@H |$0H T$@H L$XI T$0H D$8H D$`H D$`H \$HH L$PH t$@H T$XH |$0H T$@H L$XI T$0H D$8H D$`H D$xH \$@H D$`H D$`H D$`H \$8H L$@H D$0L |$HD |$PH T$HH T$0H T$PH D$XH D$`H \$HH D$@H D$`H \$8H T$@H t$hL D$0L T$0H T$PH D$XH D$`H veUH L$71 T$0H \$8H T$0@ |$@D |$HHc T$@L D$HH T$0H vHUH D$HH T$XH vvUH D$`H D$HH D$0H D$HH L$0H D$HH T$XH v0UH D$ H L$01 D$ 1 T$8H L$0H |$0H L$,L D$0L t$8H t$8H \$0H v,UH \$0H D$PH \$XH T$PH \$X1 L$X1 t$x@ |$GH L$pH \$`H L$GH l$`L D$h1 D$PH m E1 T$XH T$XL T$HA |$HI T$PM |$PI |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L T$pH L$hH D$gH L$hH T$pH D$xH D$xH L$gE T$hH t$PH t$(L D$`H D$8L D$ H T$xH D$0H D$8H \$ H |$0H D$(H L$pH t$P1 \$PH \$PH |$HH L$pL t$PE |$HL L$0H T$ D D$(H D$0H9 \$(H D$XH \$`H L$hH L$0L T$ D L$@L T$ H D$XH |$@L D$ D T$ L L$@H d$XM l$hA |$ H t$(L |$ H t$(L vmUH D$ H D$ H t$@L D$HA D$@A t$`L D$hA T$pL D$`A D$XA D$hH t$@A D$@A D$PA ,s"H D$XH \$`H L$hH \$hH L$ H L$XH L$(H L$`H L$0H D$8H D$hH D$@H D$ H v*UH \$XH L$`H |$hH D$PH L$PH \$X1 L$`1 D$(L v H9 |$0H T$8H T$8H |$0H D$PH |$ H |$ H t$(f veUH D$0H D$0H vSUH D$hH R E1 |$(D |$8D |$HH T$(H L$@H |$HH D$0H D$hH D$PH D$(H vKUH v1UH \$0H D$8H t$`@ |$/H L$XH \$0H D$hH L$/H \$xM L$0L @ H9 \$PH L$.H |$HH T$@L L$.H T$@H \$PH |$HL T$8H T$8L |$ H |$ H t$(f v`UH D$PH L$PH T$ H T$(H T$PH T$0H D$8H T$(H T$ H L$(H T$P1 t$@H T$`H |$XL D$8I D$HH L$(H T$`H \$hH t$@L \$8L t$ H L$0H T$PH |$ H D$0J D$HH \$hH H9p@w \$`H D$`Hc D$@H D$ H L$8H D$ H T$8H D$`Hc \$`H L$ H L$ H \$`Hc L$`f D$@H D$`Hc D$(f L$8H T$8H D$`Hc \$XH D$8H D$XHc L$0H D$(f L$xL D$HH |$pM T$h1 t$pH |$h1 L$xH \$`H L$xH |$pL D$HL \$`M \$PH T$PH T$XH D$`H t$pH |$hH9 T$DHc t$X1 T$pH D$PH t$XH9 D$PH \$xH L$xH9 \$@H L$@H9 H9J@ P8H9V8t P2f9V2 ~0f9 T$8L |$0H \$xH H9w@u t$x1 N@H9H@umH \$xH L$xH9 \$xH D$HH \$xH J@H9 <@H9 |$pH D$HH \$hH L$pH L$hH9 T$pH L$pH \$hH L$pH L$hH9 T$pH D$PH t$xH J@H9 D$PL L$PH \$pH L$pH9 \$pH L$pH9 L$PH L$PH \$`H T$8H |$0H \$`I T$ L L$(H D$XH L$(L T$ H D$XH v UH v UH v-UH v-UH D$ H9 f9J8v^D D$HH \$PH L$ H D$(H L$PH \$ H L$Pf D$HH L$0H L$hH T$HL |$UH L$@H D$0H T$0H L$PH |$ H |$ H t$(f v5UH D$ H \$(H D$(H L$ H D$0H \$8H L$@H D$0H L$@H \$8H txH9 L$(H \$HH |$XH t$ H \$HH t$ H |$XH D$(H vGUH \$@H t$XH |$ H t$(L D$0L |$ H t$(L D$0L vLUH \$8H |$HH \$8H |$HH D$0H \$8H D$0H H9BpwF@ T$ H T$ 1 rhL) L$XH \$PH L$HH T$(H T$XI D$0H L$HH T$(H T$0I |$HH v)UH vyUH D$ H L$ I D$(I L$(H vUUH \$HH \$(H L$HH D$ H vEUH D$8H \$@H L$HH T$8H T$ H vEUH D$0H \$8H L$@H L$0H vEUH D$0H \$8H L$@H L$0H D$ H D$@H |$ H t$(L |$ H t$(L D$@H T$@H D$@H D$ H \$ H D$ H D$ H L$HH \$:H L$HH T$@H \$:H rt H wt H T$;D = `L T$HL9 T$:D8 T$:H T$;D T$;D u D8 |$hL T$hL D$pH t$hH =u^L |$xL T$xL t$xH L$XH D$XH D$PH L$(H L$(H D$ H D$ I |$(H |$0H D$0H D$(H D$ H D$ H D$ H D$ H D$0H t$ f t$ f v/UH \$(H t$0I D$ H D$0H \$PH \$XH T$`H L$hH D$pH D$PH T$0H rpH92w D$8H D$@H T$HH D$8H T$0H D$8H D$ H D$@H T$HH D$8H \$(H D$0H L$pf I9Np t$ I D$(H D$PH D$ H D$XH D$PH L$ H |$(H9 L$0H \$@H T$HH D$0H D$ H D$ H L$ H L$ H D$ H D$ H D$(H D$ H D$(H D$ H |$0H |$0H L$0H \$(H D$8H D$8H \$(H L$0H |$0H |$0H L$0H \$(H D$8H D$8H \$(H L$0H vWUH D$ H L$ I vPUH D$ H L$ I D$ H 8alu 8weui 8noneuS1 8crasuA 8singu 8systu L$HH \$@H t$HH T$@H t$`L \$pL \$hH t$`L \$pL \$xL d$PH |$XH |$XL \$xL d$PL L$0H L$0I v%UH v%UH v%UH v%UH v%UH \$X) t$8H D$(H L$(H D$(H T$PL T$ f L$(H A(H) D$8H L$8H D$8H 9S0u t I9 D$ f v$UH v+UH L$ H L$8H D$@1 L$ H L$HH L$8H D$@1 L$HH vxUH T$8I D$PL T$ L \$ A T$8I D$pH L$HH T$8L L$8H D$XH \$pH D$XH T$@H \$(L D$XH \$@H T$(H) L$8H D$XH D$XH D$XH \$HH L$0H |$ H |$ H t$(f \$`H D$XH L$8H |$0H T$XH L$(H D$@H T$0H D$@H L$(H \$8H |$ H |$ H D$0H= w}H= L$0H9 D$ H D$ H D$hH \$pH L$`H \$XH D$hH T$XH |$`D D$CH L$`H D$hM L$xA D$CA t$DH t$DH |$HD D$CL \$PH HhH9 5l0I T$XA \$(H D$PH t$0H D$8H D$@H t$8H9 \$ H T$HH D$PH T$HH t$HH9 L$`H \$XH D$PH T$$H L$,H \$HH D$8H T$@H \$0H L$`H L$8H L$0H L$`H L$`I T$hI L$HH D$PH QpH9 L$`@ |$hH \$8H D$(H \$8H \$8H9S@ D$,H L$,H L$`H D$(H \$0H T$8H T$(H \$0H L$8H vHUH v;UH D$XL t$@I T$@I D$XL T$@M D$XH T$8L T$@I D$PH \$XH L$`L D$xH t$pH |$hH L$xH D$8H \$PH L$XH |$`H t$hL D$pE1 |$ H t$(L |$ H t$(L v@UH vEUH L$xH D$xH D$xL D$xA D$xD D$xD L$xH \$xH \$pH \$HH D$P@ L$GH |$PA \$pL \$xH L$hHi L$pH L$pH L$hH L$XH L$xH L$`H L$XH D$x1 $RM) T$hL T$xH \$pH T$hH |$(D |$8D |$HH t$`H T$ L T$(H T$0H D$8H L$HH |$PH \$@H |$ f D$@H |$XH T$(H \$HH D$@H |$XH oX0fD oxpfD d$`L l$hM d$`L l$hH T$ H t$(H l$0L D$8L L$@L T$HL \$PL T$ H t$(H l$0L D$8L L$@L T$HL \$PL l$0M9,$u l$PM9,$u v'UH M9,$u v-UH M9,$u v-UH M9,$u v-UH M9,$u v-UH M9,$u r3M;f v-UH M9,$u r3M;f v-UH M9,$u r3M;f v-UH M9,$u r3M;f v-UH M9,$u r3M;f v-UH M9,$u \$ H Genuu ineIu ntelu D$ H f8PL X0H;CPteH t]H; sPH9 t$ M D$(M L$0M T$8M \$@fA D$HfA L$PfA T$XfA \$`fA d$hfA l$pfA t$xfA t$ M D$(M L$0M T$8M ~D$H ~L$P ~T$X ~\$` ~d$h ~l$p ~t$x L$(H w H @w H w H @w H vgUH L$8H T$(L \$H \$hH D$pH L$HH L$HH L$pH t$XL D$PL L$>H \$hH D$`H D$`H L$>H |$ H t$(L |$ H t$(L v/UH l$ M9,$u \$XH L$`H |$hH t$pL D$xL L$pH9 D$(H t$pL D$xH D$hH D$0H T$pH \$0H t$ H L$(H t$pM L$ H L$0I T$8H D$(H |$ H t$(L D$0L |$ H t$(L D$0L D$`1 L$XL T$xL L$hL T$pL L$hH D$`L T$pA D$`L T$pA l$HL L$@H L$@H t$`L D$hL L$>H L$hH D$`L T$pL l$HL L$hH D$`L T$pH L$>H L$XH D$`L T$xL L$>H |$ H t$(L |$ H t$(L v/UH l$ M9,$u D$HH \$PH L$XH |$`H L$HH L$HH T$PH T$0H L$`H L$ H t$XH |$(H L$ H T$0H T$(H |$ f |$PH \$pH L$ H L$ H T$hH \$pH t$@H L$HH L$@H L$(H D$hH L$hH T$PH T$PH v/UH l$ M9,$u D$8H |$PH L$HH \$@H D$8H L$HH \$@H T$8H t$ H D$8H L$HH t$ H L$ H L$ H |$ f D$HH L$XL D$pH t$hH |$`H \$PH D$HH L$XH \$PH t$hH |$`L L$XH T$`H T$`I t$pI T$hH T$HH T$HH L$(H T$ I D$HH L$XH t$hH |$`L D$pL L$XH L$`H L$`I T$pI D$0H L$hH L$(H D$ H L$(H |$ H t$(L |$ H t$(L vkUH D$(H \$0H D$(H \$0H9S v]UH D$(H \$0H L$(H \$0H9S vMUH vsUH D$(H \$0H T$(H t$0H9F t vWUH D$(H \$0H D$(H \$0H vsUH D$(H \$0H T$(H t$0H9F t vMUH D$pL L$HL D$h1 +u E \$PD d$GH L$xA L$`D \$FL T$XH D$xH T$pH L$`L D$hL L$HL T$XD \$FD d$GL l$PE1 D$pH T$pH D$GA D$GA D$hL L$HI D$pH \$PL 9w:H T$xH D$0H t$@D |$hH T$PH D$XH T$hH T$PH T$pH D$8H D$HH D$8H t$0H |$xH T$@1 D$8H L$8A L$pH \$hH D$`H |$'D |$(D |$8H [bisect-H L$'H match 0xH L$/H L$p1 D$G]H T$`H |$bH |$fH [bisect-H match 0xH S!H9 |$ H t$(L |$ H t$(L D$ H D$8H T$ H L$8H T$ H \$@H T$8H \$@H T$8H v{UH D$0H \$81 \$8H D$0H vSUH D$0H D$0H D$`H T$@H L$8H L$`H D$HH |$@H t$8L T$(H D$HH D$HH t$ H t$ H L$(H T$(L D$hH \$pH D$XH D$Xf t$8H L$@L D$PI D$HH |$0L T$`H |$0L T$`H D$PH t$PH D$PH9 T$HH D$XH D$XH D$XH v&UH \$0H L$0H L$(I |$0H |$8f D$0H D$0H D$ H D$(H D$0H \$8H L$@H |$HH |$HH L$@H D$@H v/UH l$ M9,$u D$xH t$(L T$HL D$PL L$@H L$8H |$ H T$8H t$ H) L$@I! D$@L L$XH T$0H \$xH L$PH T$@H L$XI D$`H T$0H) L$`H D$PH D$xH t$(H v3UH \$0H L$8H v%UH M9,$u M9,$u v%UH M9,$u H H9K v5UH vNUH P H9S u |$A< t$`L tYL9 D$hI L$xH L$pM) L$pH \$xH |$ H |$ H T$PH t$HD D$GH 5`?< D$GD T$HH T$PH T$PH D$GD8 |$ H |$ H D$xH \$pH T$xH T$pH \$XD |$@D |$Hf D$@ m D$B= L$CI 6A_p 6A_p D$`L) |$hH |$hH 5==< L$XH |$BD |$HD |$XD |$hD |$xH time.DatH T$Bf D$Je( 56;< , ti ime.L 5/:< 5P9< 5B8< time.LocL time.LocH ocation(H 5^7< time.UTCL @}$D |$@D |$PD |$`D |$ H |$ H L$xH L$PL \$HH D$@H D$@H L$PH \$HH D$@H \$HH L$PH D$@H L$PH \$HH D$@H \$HH L$PH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L sXH 5--< 5r,< !u+H 5Z*< |$`D D$s0 D$tH D$@H D$0L D$_L |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L L$pH |$p1 L$`H |$pH \$hD L$`H |$pA \$hL D$Hf L$`H |$pL \$hL D$PE1 \uFH D$LH D$LL \$hH |$pIc L$hH t$pH9 L$hH T$hH t$pH D$pH L$hH T$XL \$xL D$PL T$XH L$`H \$xf \$CH D$PL T$XD \$CL L$`D \$CH D$PL T$XD \$CH \$HH \$@H \$8H |$PH L$PH L$HH L$hH L$`H L$pH T$@H T$8H 8 u7 \$HH D$@H L$PH |$XH L$PH \$HH L$PH \$HH D$@H L$PH \$HH |$XL T$GH |$GL |$FL 8UTu^ CuXH |$GH |$GI 8ZubH |$GI :tUH H 8K u v>UH H 8K u v?UH D$@H \$HH D$@H D$(H \$@H L$HH ='vQ \$(I v/UH D$@H \$HH D$@H D$(H \$@H L$HH \$(I v=UH D$@H \$HH |$HH \$hH |$ H \$0H \$0H D$8H D$@H D$8H D$ H T$HH D$ H \$(H L$`H D$ H \$(H D$ H \$(H v/UH l$ M9,$u D$@H \$HH D$(H T$@H D$HH H9L$ D$8H \$@H L$HH |$PH T$ H T$ H \$8H L$@H D$0H \$8H L$@H D$0H L$@H \$8H \$0H |$8H t$8L |$8H t$8H D$@H D$ H L$xH t$PH t$XH t$PH |$(H t$(H |$(H t$(H |$0H D$HH L$xH |$HH T$`H D$ H D$ H v/UH l$ M9,$u T$(H T$(H \$ H \$ H D$8H T$HH L$8H T$HL T$8H D$0H \$PH |$PH \$@1 T$PH L$XH L$`H D$hH |$ H |$ H L$8H D$PH \$@H T$XH L$@H |$`D |$pH L$pH D$`H D$`H \$01 L$8H D$HH D$8H L$@H D$X1 vvUH L$0H \$8H D$HH T$PH D$@H \$XH D$0H L$8H |$XH D$P1 D$8H \$ H \$@H D$8H L$8H v6UH T$HI |$PI L$0E L$0H |$PL |$8I t$8L |$8H H9t$8u |$XH t$0L T$XH |$ H t$(L |$ H t$(L vLUH L$@H |$HH D$0H \$8H L$@H |$HH v6UH D$8H |$XH t$pH |$HH L$@H |$@H t$HL L$@H T$HH D$pM D$hL D$@H \$HH L$8H T$hH \$xH \$xH L$hH L$hI L$hH L$hI \$XH L$`H D$XH L$PH \$`H T$XH T$hH T$`H T$hI D$PH T$XH \$`H D$XH \$`H L$PH D$XH \$`H D$XH \$`H L$PH |$ H t$(L D$0L |$ H t$(L D$0L v/UH v2UH v/UH l$ M9,$u v,UH D$xH \$hH D$pH \$`H |$ D |$0H D$@H T$hH T$xH T$`H T$pH L$XH |$`H t$hL D$pH |$HH L$HH T$01 L$HH T$0H L$HH |$ H t$(L |$ H t$(L vMUH \$PH L$XH \$PH D$0H \$8H L$@H |$HH t$PL D$XH \$8H L$@H |$HH t$PL D$XH D$0H L$0H L$8H T$HH L$8I T$HI t$XI L$@H L$PH |$ H t$(L |$ H t$(L D$@H \$HH D$@H D$@H D$ H \$(H L$ H \$(H \$ H |$0H L$(H L$8H L$0H L$@H L$ H L$XH L$PH L$`H \$xH D$pH \$8H L$@H D$0H L$@H \$8H D$0H L$@H \$8H L$0H D$HH \$PH |$`H L$XH \$(H |$`H t$0L D$ H L$XH t$0H |$`L D$ L L$XH \$(H |$`L L$XH \$(H |$`L L$(H \$(H D$(H \$0H T$(H t$0H9F T$(H t$0H9F t M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u v'UH D$ H M9,$u v$UH M9,$u v/UH \$ H L$(H M9,$u v$UH M9,$u v/UH \$ H L$(H M9,$u v$UH M9,$u v/UH \$ H L$(H M9,$u v$UH M9,$u v?UH D$(H \$0H L$8H |$@H t$HH |$ H t$(f |$ H t$(f l$(M9,$u v.UH \$0H L$8H l$(f M9,$u M9,$u M9,$u M9,$u vKUH l$8M9,$u vuUH \$HH L$PH L$PH \$HH T$ H L$(H L$HH |$PH l$@M9,$ \$8H D$0H \$8H L$@H D$0H L$@H \$8H l$0M9,$ vEUH \$ H L$(H |$0H t$8L D$@H D$ H |$ H t$(L |$ H t$(L M9,$ v$UH M9,$u vEUH \$ H L$(H |$0H t$8L D$@H D$ H |$ H t$(L |$ H t$(L M9,$ v$UH M9,$u vEUH \$ H L$(H |$0H t$8L D$@H D$ H |$ H t$(L |$ H t$(L M9,$ v$UH M9,$u v=UH v+UH vrUH 4s'H t%fI 0CH9 sD 0u1M fwGI9 teL9 T$0L d$(L l$ L T$0L d$(L D$ H D$0E1 0r+A D$@H \$H1 T$ H D$@H \$HH L$ H9 L$ H D$@H \$HH 85s3H L$ H |$(H) D$@H \$HH T$(H |$(H D$@f L$HH D$(M t$(H D$XH |$(I |$(L9 T$@D t$(J T$ H \$`H D$XH D$8H \$XH T$8H D$0H T$0I T$@H t$(L L$ H |$ H t$(D D$0D |$ H t$(D D$0D D$PH L$3@ |$2@ L$3H D$4H D$PH u/z- |$`H |$hH D$`H |$@H L$@H D$`H |$8H L$8H |$HH L$HH D$PH L$7@ L$7H D$XH D$PH L$Xf u/z- |$hH |$pH D$hH |$@H L$@H D$hH |$8H L$8H |$HH L$HH \$`H T$`H9 A H9 D$ H L$8H \$(H L$8H T$`H \$(H D$@H \$XH T$@H |$`H9 D$0H L$0I v-UH D$ H T$XH t$pH L$`H |$pH t$XA D$hH \$PH |$xH T$xH t$PH t$hH L$xH \$pH D$hH L$xH D$PH \$xH T$PH L$PH L$8H |$(H \$0H D$@H L$0H L$@I D$HH L$pH L$hH T$8H L$hI T$8I \$HI L$(H |$ H |$ H L$xH \$pH D$hH L$xH D$PH \$xH T$PH L$PH L$8H |$(H \$0H D$@H L$0H L$@I D$HH L$pH L$hH T$8H L$hI T$8I \$HI L$(H |$ H |$ H D$Xf 80urH \$`L L$@H |$01 D$8H \$@H T$8H |$`f L$`H T$8f T$8I D$0H D$8H \$@H T$8H L$`H T$8f T$8I D$0H D$8H \$@H T$8H L$`H T$8f T$8I D$8H \$@H T$8H L$`H T$8f T$8I d$(L d$(L D$`1 D$8H \$@H T$8H |$`H9 L$`H T$8I D$`f \$hH |$xD L$'H \$8H L$HH D$(H L$HH L$xH |$'@ D$h1 D$@H \$`H T$@H L$hH T$@f T$@I T$0H D$h1 D$@H \$`H T$@H L$hH T$@f T$@I T$0H D$h1 D$@H \$`H T$@H |$hH9 L$HH \$8H |$ f D$8f \$@H D$ H \$8H T$ H L$@H T$ f T$ I D$ H \$8H T$ H |$@H9 L$@H T$ I 80u8 D$(H R|#H D$(H D$(H 5u3H 5u-H Xu$L T$_L |$`D T$`H T$_H T$`H T$_H |$xD T$xH Gw)A Et)A eu&H fu)H T$_H D$ @ |$(H t$0L |$(H t$0L |$`H |$hH D$`L D$`H eu&H ftGA gu0uRH |$ @ t$(D t$(D dsYH dsYH D$hf t$0H \$pH T$HL T$HH t$0I \$pH L$@L D$8H D$PH D$PH \$8H L$@H |$ H |$ H t$(f D$hf T$HH \$pH t$0L 5zZ: T$HH t$0I \$pH L$@L D$8H D$PH D$PH \$8H L$@H |$ H |$ H |$/D |$0D |$@D |$PD |$`E |$xH T$pH 5:X: T$pH |$xI L$xH D$pH \$pH L$x1 Aw7H AsIE |$ H t$(D D$0D |$ H t$(D D$0D L$PH T$PH \$hH |$xH t$`D D$pH T$XH T$XH t$`H |$xD D$pH \$hH L$HH t$`H |$xD L$HH \$hf \$GH t$`H |$xD \$GL L$HD \$GH t$`H |$xD \$GH L$HD t$`H |$xD L$HH9 5lQ: |$ H t$(D D$0D L$1D |$ H t$(D D$0D L$1D T$2f D$P@ t$lH |$hD D$mD |$hD D$mD L$n@ 5'P: |$ @ t$$D D$%D t$$D D$%D |$x@ L$pH \$hH D$`E L$pH 57O: |$x@ |$xf |$x@ \$hH L$pH9 5QN: |$x@ D$`H \$hH D$`H L$pH \$hf \$hf 5|M: \$hf |$xH \$hf |$DH |$DH \$hf 5|L: |$xH \$hf 55L: T$xD D$CL \$hf \$hf 5jK: \$hf 5=K: \$hf L$HD L$CH D$DD L$CH L$HH L$HD L$CH 5SJ: D$xD L$CH L$HH JfA9 |$ @ t$$D D$%D t$$D D$%D wqH) D$ f \$(H L$(H9 wDH) T$ H vCUH L$BH T$PH L$HH D$hD L$HH L$HH L$HL D$hH "uJH \$HH T$hA 'uhH \$HH T$hH9 T$hE1 L$HL L$HL T$HH L$xH D$xD T$BL T$P1 T$BH D$xH \$pL |$XH \$pH T$xI9 D$DH 5#>: |$XD D$DH \$pH |$XD \$pH T$xD \$hL9 r,H) }nH9 \$`D L$CL L$CI L$HH \$`E L$HH BfA9 4rf9 BfA9 D$(H \$0H T$0H T$(H T$(H t$0H9F t D$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H L$ I D$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H L$ I v^UH D$ H @fD9 D$ H vmUH P0H9 L$0H vEUH vFUH w2Hc D$ H \$ H \$ H \$ H \$ H \$ H L$ I D$ H \$ H \$ H L$ I D$ H D$(H |$0H D$0H D$HL D$HH T$PL D$XA D$hA D$xA |$PD |$`D |$pH L$`I T$hI L$@I D$PH L$HL L$HH |$PD |$`D |$pH D$hL L$GL L$GH D$PH T$H1 =rA| T$h1 t$`H T$hH {@H9 t$`H D$pI |$pD D$xH T$PL T$PI D$pI |$pD D$xH T$XL 5}$B T$XI D$pI |$pD L$xH 5e#B T$HI D$HI D$XA D$hA |$HD |$XD |$hI L$HL T$PL D$XL L$hH T$@L 55!B |$ @ t$PL t$PL t$`L D$XL \$HH t$`L D$XL \$HI9 D$Ff D$Df vZUH vZUH T$XH T$XL r1A |$PL T$PH T$?H T$?L w)H w*I D$`H D$`H9 t$hH t$hL T$HH T$HH T$@H T$@H D$p1 L$xH D$pH9 L$xH |$ H t$(L D$0L |$ H t$(L D$0L L$xH t$xH \$@H |$hH t$XL L$HH \$pH T$`M t$XH |$hL L$HL \$@H D$`H \$pH T$PH L$8M L$8H T$PH |$hL D$XL L$HL \$@I D$`H \$pL9 D$`H \$pH L$HH |$XH t$hL D$@L |$ H |$ H t$(f D$H1 }`H D$pH \$xH T$@H \$XH D$PL D$PH t$XH t$XH T$PH |$@H \$8H D$HH L$8H L$HH L$@H L$HI |$ H t$(L |$ H t$(L v1UH L$8H vxUH vxUH D$(H L$(H T$HH \$pH D$hH T$HH \$pL D$hH T$HH \$pL @0L9 L$PH |$8L D$hH D$hH T$pH \$pH L$PH D$hH T$pH L$XH T$hL D$hH T$pH \$pH \$@H D$`H L$@H L$`H L$HH L$`I |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L vyUH D$ H L$ H L$ I vWUH |$0H H9X@ D$0H \$8H D$@H \$HH D$@H \$HH L$PH D$XH D$xH D$XH D$XH T$h1 t$`H T$hH x@H9 t$`H |$pH t$pH t$pH D$XH \$`H D$XH \$`H D$HH |$`H D$(L L$ H t$0H L$XH t$0H |$`L D$(H |$ f |$0H |$8H H9X@ |$PH t$XH D$0H \$8H D$@H \$HH D$`H \$hH L$pH D$xH L$xH D$pH D$pH D$~L \$~L \$~1 J@H9 D$pH D$pH @@L9 D$pH \$xH D$pH \$xH v,UH D$(H9Z T$hH t$ H |$`1 L$@H H9K@ p@H9 L$@H T$PH t$@H9 \$XH L$XH9 L$@H L$PH \$0H D$xH L$0H9 T$PH H9P@ L$8H L$hH t$ H |$`I H@M9 L$8L D$HH L$8H T$ H9 \$XH L$XH9 L$HH \$(H D$pH L$(H9 T$HH H9P@ D$(H D$(H D$(H D$(H D$HH \$ H D$0H L$ H9 D$(H D$HH \$P1 D$pH P2f9S2u P0f9S0u S8H9P8t P@H9S@t P@H9S@u[H \$@H D$XH L$xH L$@H9 T$pH \$@H t$x1 \$@H |$pH t$xH J@H9 <@H9 |$8H L$PH T$HH \$0H D$XH L$8H T$HH L$0H9 T$8H t$PH t$HH L$8H T$PH \$0H D$XH L$8H T$HH \$8H t$PH D$HM T$(H D$pH p0H9 C0fE T$(H T$ H D$pH wUL) T$ H \$0H T$0H T$hH T$pH T$hf T$@H \$(H L$8D |$xD t$XH t$xH t$`H t$XH T$(H T$@H |$8H L$HH D$HH \$PH |$HH D$HH \$PH D$HH \$PH v/UH l$ M9,$u L$`H L$`f D$xH T$xH L$`H %@cP L$pL t$LH t$LL L$pL l$CE l$DE l$EE \$F1 t$LM T$pL t$LD T$pL |$HA |$IA |$JE l$K1 B0fD t$TH D$p1 T$PH t$p1 \$p1 L$hH L$hH \$X1 D$hH t$pf D$hH D$hH D$pL9 D$hH lPD D$pL L$XL |$ H t$(L D$0L |$ H t$(L D$0L s*H L$PH \$hH D$`H \$hH L$PH D$`A D$XH \$HH |$XH t$HL |$ H |$ H D$XH \$`H L$0H \$@H D$8H r H D$8H \$@f T$ H D$8H L$0H \$@H |$ H9 D$8H \$@H D$(H D$(r D$8H |$(H9 D$8H \$@H L$HH L$HH T$xH L$pH L$HH T$xH L$pL \$8H L$HH T$xH L$pL \$8L L$HH T$xH L$pL w)I w)H D$@1 D$P1 D$hH T$hH9 L$XH L$XH L$pH rUH L$`H D$@f L$`H L$pH L$xH L$xH L$xH L$xH |$ H t$(L |$ H t$(L D$0H D$0H D$0H H9P0 D$0H D$0H \$81 D$0H L$0H |$8H D$ H \$(H T$(f T$(H t$ H \$0H L$8H D$(H t$ H vgUH \$0H L$8H D$(H \$ H \$8H L$@H D$(H t$ H \$ H \$ H vsUH |$hH t$pH L$`H D$PH \$XH D$0H \$8H L$(H |$XH L$(H T$PH D$0H \$8H |$ H |$ H t$xL |$pH L$hH D$XH \$`H D$8H \$@H L$0H |$`H t$hL L$0H T$XH D$8H \$@H |$ H t$(L |$ H t$(L t$xL |$pH L$hH D$XH \$`H D$8H \$@H L$0H |$`H t$hL L$0H T$XH D$8H \$@H |$ H t$(L |$ H t$(L D$8H \$@H |$PH t$XH L$ H |$ H |$ H D$8H \$@H |$PH t$XH w!H L$ H |$ H |$ H D$8H \$@H |$PH t$XH L$ H L$ H |$ H |$ H D$8H \$@H |$PH t$XH L$ H L$ H |$ H |$ H D$8H \$@H |$PH t$XH L$ H |$ H |$ H D$8H \$@H |$PH t$XH w!H L$ H |$ H |$ H t$(f D$@H \$HH |$XH \$(H L$ H t$`H r H L$XH T$ H \$XH T$ H \$XH T$ H L$ H |$ H |$ H D$@H \$HH |$XH t$`H L$(H L$(H |$ H |$ H t$(f D$@H \$HH |$XH t$`H T$(H t$`H |$X1 T$(H t$`H |$XH L$(H |$ H |$ H D$@H \$HH |$XH t$`H w(H t$`H |$XH T$(Ic T$(H t$`H |$XH L$(H |$ H |$ H t$(f D$@H \$HH |$XH t$`H T$(H9 |$XH t$`H |$ H |$ H D$HH \$PH t$hH |$`H D$0H t$`L D$hH |$ H |$ H vnUH D$@H \$HH t$`H |$XH T$(H |$XH t$`H |$ H |$ H D$HH \$PH t$hH |$`H D$0H t$`L D$hH |$ H |$ H D$xH L$`H \$pH D$HH L$`H \$pH T$XH D$xH L$`H T$XH \$pH D$HH9 L$pH L$`H D$hH \$PH |$hH t$PL |$ H |$ H L$`H D$HH L$`H T$XH L$`H T$XH D$HH9 D$hH D$xH L$pH L$`H D$hH \$xH \$PH t$PL |$ H |$ H D$HH \$PH |$`H t$hH \$0H D$(H L$0H D$ H \$(H |$ H |$ H D$`H \$hH |$xH L$(H \$HH D$@H D$8H D$@H \$HH L$(1 D$ H \$0H L$xH L$ H T$8H L$0I L$xH \$ H L$0H L$xH L$(H \$8H |$ H |$ H D$@H \$HH t$`H |$XH |$XH L$(H T$(H L$(H |$ H |$ H L$HH T$HL L$HH |$ H |$ H voUH v`UH vsUH v-UH H0fE L$pL L$pL L$xH l$hL L$x1 l$hI D$XH D$XH t$hH |$hL D$xL9 t$pL D$XH \$`H D$XH \$`H v-UH L$xH L$xH L$xH D$pH D$pH D$pH \$xH D$pH \$xH vTUH vTUH D$0H D$XH I9H0u L$hH L$hH L$`H D$xH D$xH L$`H D$XH \$P1 D$xA \$(H D$ H \$(H L$0H L$(H voUH \$0H L$8H D$(H vTUH \$(H L$0H D$ H \$@H t$X1 L$`H T$PL D$HL T$hL L$`H \$@H t$XH l$hL L$`H T$PH \$@H t$XH D$HL T$xH Hc J |$pI l$hH t$XH L$`H \$@M9 |$pH Hc J D$@H L$(H L$(H D$ H D$(H M9,$u D$ H D$(H M9,$u D$(H \$0H T$(H t$0H T$(H t$0f H9F uFH L$(H \$0H9S0u!H Q8H9S8u Q@H9S@u IHH9KH vwUH l$8f M9,$ v+UH M9,$u v`UH M9,$u v5UH l$(M9,$u v5UH l$(M9,$u v5UH l$(M9,$u M9,$u vJUH l$(M9,$u v5UH l$(M9,$u v5UH l$(M9,$u l$(M9,$ M9,$ vWUH l$(M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u D$ H \$(E D$0H \$8H L$@H |$HE l$0M9,$u D$0H \$8H L$@H |$HE l$0M9,$u v5UH H H9K u(H H(H9K(u H9K0u H8H9K8 vKUH v1UH T$(H L$xH r H L$xH T$pH |$@H T$pH L$xH L$@1 L$PH T$HH L$xH T$xH \$HH L$PH9 T$hH \$`H L$XH L$XH T$hH \$`H L$HH |$PH \$HH L$PH D$xH L$pH L$pH D$xI L$HH L$pH D$xL L$HL L$pH T$hH L$xH t$7H t$7H @81t#@ wBH D$`H T$`H9 D$8H L$8H L$pH L$xf L$xH \$@H \$@H D$`H T$`H9 D$XH L$pH D$XH |$XH9 L$hH L$xH D$PH L$pH D$PH |$PH9 L$hH L$xH L$xH L$xH L$hH L$xH L$xH L$hH L$xH L$hH L$xH L$hH L$HH |$ H t$(L |$ H t$(L D$(H \$0H |$@H t$HH |$ H t$(L |$ H t$(L vVUH D$pH \$xH D$pH \$xH |$@H t$HL D$8H \$@H L$HH |$PH t$XL D$8H \$@H L$HH |$PH t$XL \$pL \$`N D$ L T$pH \$`E T$pH \$xM \$hN D$ L T$xL \$hE T$xL |$ H t$(L |$ H t$(L d$`f \$hL d$ I D$ L ~`M9 d$`L }VI9 D$pL d$ I D$ L L$xH d$ I D$ L |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$8M9 T$X1 T$PL) t$@E1 T$H1 T$xH D$ L L$`H |$pL \$hH \$hH D$ H T$HH |$pL D$8L L$`L T$xL T$(L \$xL |$pL l$hL d$`H \$pH T$PH t$@H D$8L T$(L \$xL d$`L l$hL |$0L T$xL l$pL d$hL \$`H \$pH T$XH |$0L D$8L T$xL \$`L d$hL |$ H t$(L D$0L L$8L T$@f |$ H t$(L D$0L L$8L vjUH L$@H D$0H \$8H T$0H D$8f |$HH L$@H L$@H T$0H \$8H D$HH \$PH L$XL9 D$pH D$HH |$`H t$hH L$XH \$P1 T$(H t$`L D$HL L$XL T$pH |$hH D$PL |$`M L$XH \$PI9 T$0L L$ H T$(L L$ L |$ H t$(L |$ H t$(L t$hH D$HH |$`H L$XH L$XH T$`I T$hH \$PH T$hH9 |$ H |$ H vJUH D$HH \$PH L$XH |$`H t$hH |$ H t$(L D$0L |$ H t$(L D$0L D$xL t$ H L$xH L$ H L$PL D$HH t$`1 D$HL L$PH t$`H D$@H \$0H L$XH T$PH9 D$(H t$xH \$`H T$(H9 t$@H ukH9 L$XH \$0f t$8H t$81 L$XH \$0H L$xH |$ H t$(L D$0L |$ H t$(L D$0L vbUH \$8H D$0H T$0H)B \$`H D$XH \$@1 \$@H D$0H T$XH D$`H T$0H T$(H L$8H \$ H \$ H9 \$ H D$(H L$8H D$(1 D$0H \$8H L$@H |$HH |$HH L$@H L$@H D$xH L$PH T$HH D$`H t$xH T$HH D$PI9 t$HH uJI9 D$`L T$HH9 L$XH \$@H t$HL D$P1 t$HL D$PH \$@H L$XH D$`H D$HH |$`H L$XH \$PH \$(H D$ H L$0H9 T$HH D$ H L$0H D$ H L$0H \$(H L$0H D$HH L$XH \$PH L$0H T$HH vPUH L$PH \$HH D$@H \$HH L$PH D$hL \$pH L$xH T$HE1 d$PI L$xH \$pH T$HL D$hM9 L$8L \$@H T$PL =E:N T$@H T$hH T$8I9 T$hH |$8H9 |$ H t$(L |$ H t$(L |$XH L$PH \$HH T$(H t$ H \$HH |$XH t$ H T$(H L$PH9 \$xH L$XI T$@I \$xH t$@H |$0L D$(H D$PH T$XL L$ L T$HM T$HL \$ I D$PL D$(H |$0I T$(H t$0H T$(H t$0H |$PH t$@L |$8M! |$8I T$XH \$xH t$@H |$0L D$(L T$HL \$ I t$@M \$HH L$PfD T$ H L$PH \$HH L$PH T$ H \$HH T$(H T$(H v/UH l$ M9,$u L$0H L$0H D$ H L$(H D$ H T$8H v/UH l$ M9,$u |$PH |$`D |$pL L$pL L$HL L$xH T$`H D$`H \$01 \$HH T$PH L$8H L$8H L$@H D$81 vjUH \$@H L$HH D$8H |$`H D$`H \$hH L$@H D$@H) L$XH T$PH) T$pI T$PH L$HH \$pM |$xD T$xL D$xH \$81 D$XH L$HH9 D$`H D$@H \$`H L$hH D$@H L$hH \$`H D$@H \$`H L$hH v/UH l$ M9,$u vjUH \$@H L$HH D$8H vYUH D$ H vYUH D$ H vRUH D$(H \$0H L$(H T$0H9J v7UH \$(H L$0H l$ M9,$u M9,$u M9,$u M9,$u v8UH D$0H \$8H L$@H |$ H |$ H M9,$u v)UH \$8H l$0M9,$u M9,$u v8UH D$0H \$8H L$@H |$ H |$ H M9,$u v)UH \$8H l$0M9,$u \$8H L$@H \$8H L$@H L$@H \$8H l$0M9,$ M9,$u v5UH M9,$u v,UH l$ M9,$u vAUH P 9S H9S( P09S0u} P49S4uuH H9S8uiH D$(H \$0H |$09wHu0 9wLu"H BPH9GPt |$HD |$XD |$hH |$XH D$HH \$P@ L$`H L$hH D$XH T$PH t$pH9 \$HH9 L$`H |$pH9 D$XA /u H D$pL9 |$@M L$HG L$8H L$8H L$`H L$hH D$XH T$PH t$pf \$HH9 |$@H L$`L D$pL9 L$XC D$pH D$pH L$PI9 L$HG L$8H L$8H L$`H L$hH D$XH T$PH t$pH9 \$HH9 |$@H L$`L D$pI9 L$XC D$pH D$pH L$HG L$8H L$8H L$`H L$hH D$XH T$PH t$pf \$HH9 |$@H L$`L D$pI9 L$XC D$pH T$(u L$ H |$pL D$PL9 L$HE D$8H L$8H L$`H L$hH D$XH T$PH t$pH9 \$HH9 L$ H T$(H |$`L D$pI9 |$XB T$hH L$pH9 T$PH L$pH9 D$HH L$0@ D$pL L$PM9 T$HG L$8H L$8H L$`H L$hH D$XH T$PH t$pH9 \$HH9 L$0H T$(H D$`L L$pM9 D$XC D$pL D$pL9 L$XM L$`L9 L$PL9 T$HG D$ H r7H) \$@H D$`H L$XH D$xH T$XH9 L$HH D$hH D$xH D$hH \$HH t$pH L$PH T$XH \$PH L$XH9 |$@H \$PH |$@H \$PH D$pH T$PH L$XH \$`H \$PH L$XH9 \$PH D$pH D$`D |$(1 5NuC L$HH T$8H L$HH T$8H D$`H 5bMC L$@H T$8H L$@H T$8H 5(MC D$`H sP@ veUH D$hH L$hH v"UH \$ H v'UH \$ H v"UH \$ H v8UH D$ H \$(H D$(H \$0H T$0H T$(H T$(H t$0H9F t d$`D \$GE D$PtrD D$PD \$GD d$FH D$PD \$GD \$FH d$`I D$hH t$XH T$xL \$hL9 T$HH T$xL \$HL9 L$pL D$pH ~nH9 \$GE |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L \$Pf L$XH t$0H \$PH L$(M9 L$XH \$PL D$ L L$(L D$ M L$XH \$PL D$ L L$(L |~L9 D$(M9 L$XH \$PL D$(L L$ L L$ M L$XH \$PL D$(L L$ L |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L \$Pf L$XH \$PH t$0H L$(M9 L$XH \$PL D$ L L$(L D$ I L$XH \$PL D$ L L$(L t$0f |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L L$pH \$hL L$pI T$0M9 D$(H L$pH \$hL T$ I L$pH D$(H |$0M9 T$ I T$HI D$@I t$hL D$@M T$HM D$(H L$pH \$hH |$0L D$(L |$0L T$@H T$HH D$@I D$8J t$8L D$hM T$HO D$(H \$hH |$0L |$ H t$(L D$0L |$ H t$(L D$0L |$XL T$PH d$xN d$pN d$hH T$HM D$`H D$XL L$xL T$HL D$XH t$pL D$PL L$hL T$HL D$`L |$XI L$HH |$ H t$(L D$0L |$ H t$(L D$0L t$hL d$0L L$xL L$XH \$PM D$0H D$hH L$0H t$XL D$xL9 \$PO D$(H L$ H D$ H L$PN D$0H D$0H |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L \$0I) L$8L ,;L9 D$8M |$ H t$(L D$0L |$ H t$(L D$0L D$pH \$xI) D$PI T$XI T$HH T$HH D$pH \$xH D$PL \$XH \$@L \$@I \$xH T$pH |rH9 |$ H t$(L D$0L |$ H t$(L D$0L L$hH L$hL t$8L \$(L d$@H t$ I L$hH \$`H t$ L L$hH \$`H t$ L \$(J D$@L \$8M t$0H t$0L D$`M T$@O |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L M9,$u v+UH M9,$u M9,$u v/UH M9,$u v/UH M9,$u vSUH l$0M9,$u v4UH M9,$u t$O@ |$xD D$xH \$xH9 t$OH |$pM L$xG L$hH L$hH \$xH9 t$OH |$pH L$xG L$hH L$hH \$xH9 t$OH |$pH L$xG L$hH L$hH \$xH9 t$OH |$pH T$Xu L$PH L$xE D$hH L$hH \$xH9 L$PH T$XH t$OH L$pH L$pH \$xH9 L$pH D$/H L$pH L$`@ |$.L T$xG L$hH L$hH \$xH9 L$`H T$XH |$.L T$xG D$ H r3H) vbUH D$8H D$8H T$ H v/UH l$ M9,$u vFUH vFUH vFUH vfUH \$HH |$@H T$HH D$8H D$8H |$ H t$(L |$ H t$(L vCUH u$Hc |$PH D$8H \$8H L$@H vMUH v[UH L$@H t$8H T$@H |$ H |$ H D$8H D$0H D$(H D$ H L$(H \$ H L$(I \$ I t$8I L$0H t$(H L$0I t$(I |$ I v`UH L$ H L$ H D$8H L$(H t$0H t$ H D$8H T$@H vdUH D$0H v'UH D$XH \$`H L$hH D$h1 D$(H L$8H= D$XH \$0H D$ H L$@H T$(H |$8L t$8I T$ H t$8H D$0H D$ H L$@H \$0H t$8H T$ H D$0H D$ H L$@H \$0H t$8H T$ H D$0H D$ H L$@H \$0H t$8H T$ H D$0H D$ H L$@H \$0H t$8H T$ H D$0H D$ H L$@H \$0H t$8H T$ H t$8H D$ H L$@H \$0H t$8H L$xH L$xH T$hL L$pH T$hH T$XL D$8H \$XH L$`H t$XH |$`H D$8H D$HH L$PH \$@H D$HH L$PH \$@H D$8H \$XH D$8H \$XH L$`H D$8H \$XH L$`H v%UH M9,$u v%UH M9,$u \$@H L$HH \$PH L$HH L$0H T$8H \$@H \$(H D$ H D$ H \$(H D$0H T$XH D$0H \$8H D$0H \$8H v%UH M9,$u D$@H L$(H L$(H T$ H L$@f vqUH v.UH v.UH \$(H \$(H L$ H |$ H \$0H L$8H |$@H D$0I D$8H D$pH D$0A |$HH T$PH |$HH D$ H T$XH D$ H \$(H T$XH \$(H D$ H |$ L D$(H D$ H \$(H |$ H |$ H v%UH M9,$u T$ H L$(H t$0H L$(H T$8H \$ H \$ H v%UH M9,$u vgUH ;fileu D$ H v|UH D$0H L$0H L$0H D$(H T$ H L$(H \$0H L$(H T$8H \$ H \$ H v%UH M9,$u t$pH D$xH t$pH D$PH D$(H \$PH L$XH D$(H \$PH L$XH t$PH |$XH D$(H t$0H D$8H L$hH \$HH L$hH D$@H \$HH L$hH D$8H D$(H \$PH D$(H \$PH L$XH D$(H \$PH L$XH v%UH M9,$u L$HH |$xH L$(H L$(H \$hH |$xL L$HI \$8H D$0H L$@H L$8H L$@H |$ H |$ H t$(f D$PH D$PH D$hA D$hH |$`I \$xH) L$XJ D$pH t$Xf t$hH t$hL t$hH9 t$hL D$p@ t$hL t$hL L$XH |$`L D$pH t$PH D$PH t$PH D$PH t$PH D$PH D$PH v%UH M9,$u |$XD |$HD |$XD |$HH D$8H D$ H \$XL D$8H |$HH t$PH L$`L L$@H |$XD |$HH T$8L T$@H D$ H \$XH |$HH t$PH L$`I D$0H t$(H |$pL L$xL D$0H t$(H |$pI L$xL D$0H t$(H |$pI L$xL t$(H |$pL D$0L D$0H \$xH t$(H |$pI |$XH |$HH t$PL D$8L D$ L D$8H \$XH |$HH t$PL L$@H L$`H D$ H \$XH L$`D |$HL D$8L D$ L D$8H \$XH |$HH t$PL L$@H L$`H D$ H \$XH L$`H |$HH t$PL D$8L L$@H v%UH M9,$u t$@H \$xH L$HH t$PH L$HH L$0H T$8H \$xH t$@H \$(H D$ H D$ H \$(H D$0H T$XH D$0H \$8H D$0H \$8H v%UH M9,$u L$ H L$ H L$ H |$HH D$`H D$`1 T$8H D$@H T$8H D$ H T$HH D$ H \$(H T$ H t$(H T$hH \$`H D$ H T$HH D$ H \$(H T$HH \$(H D$ H D$ H \$(H v%UH M9,$u |$@D D$xH D$xH L$PH L$XH L$PH D$@H \$0H T$`H D$ H |$0H \$@H L$HH t$8H T$(H T$ D |$@D T$`H D$ H |$0H \$@H L$HH t$8H D$ H \$@H L$HH |$0H t$8H v0UH l$ M9,$u D$`H T$hL D$pH T$hH T$HH t$PH D$(H D$`I D$0H L$XH \$@H L$XH D$`H D$8H \$@H L$XH D$0H \$XH L$(H D$HH T$xH D$(H \$HH L$PH D$(H \$HH L$PH v%UH M9,$u D$@H \$HH D$@H L$PH \$HH \$(H D$ H D$ H |$ f linu linuu D$pH \$xH D$0H \$(H L$PH D$0H L$PH \$(H D$8H D$pH \$xH L$8H L$XH D$H@ |$'H D$HH T$0H D$x1 D$HH L$XH L$0H L$/H L$`H D$0H |$/H D$0H |$/H D$0H |$/H D$0H |$/H D$8H L$0M) t$0H D$0H H9T$0 T$@H D$@H H9T$0 |$/H D$@H D$@H D$@H D$0H |$/H D$0H |$/H D$0H |$/H |$/H D$0H |$/H v%UH M9,$u v=UH |$ H |$ H vRUH T$0L D$8H T$@H t$HH T$@H |$,H D$0H T$PL D$0H \$8H D$0H \$8H v%UH M9,$u |$`H D$xH |$@H D$@H L$HH \$8H t$PH \$XH t$PH D$ H L$@H |$H1 L$0H \$@H D$(H T$8H \$@H L$HH D$ H t$8H)F L$0H) t$8H T$`H D$ H |$HH T$`H D$ H |$HH L$@H |$HH v%UH M9,$u T$pH D$xH T$pH D$PH D$8H \$PH L$XH T$PH t$XH D$8H \$@H D$HH L$hH D$@H D$HH L$hH L$HH L$8H D$PH D$8H \$PH L$XH D$HH L$hH \$@H D$8H \$PH D$8H \$PH L$XH D$8H \$PH L$XH v%UH M9,$u D$`H D$8H \$`H L$hH T$`H t$hH D$8H D$HH L$@H \$PH L$xH D$XH L$HH D$XH L$xH \$PH L$HI) T$@I L$HH L$@H L$8H D$`H D$8H \$`H L$hH L$xH \$PH D$@H D$8H \$`H D$8H \$`H L$hH L$8D D$8H \$`H L$hH D$8H \$`H L$hH v%UH M9,$u vPUH D$ H \$ H vSUH D$0H viUH |$ H T$ H T$(H v7UH D$HH D$HH L$hM L$pH D$XM L$hL \$`I D$XH \$`I L$hL T$PH t$XH \$`H D$HH D$HH |$xH |$xI D$XH L$pH D$XL D$HH v%UH M9,$u M9,$u M9,$u M9,$u D$@H D$8H D$ H D$0H D$(H L$0H T$ H \$(H L$0I T$ I \$(I t$@I L$8H \$ H t$0H L$8I \$ I t$0I |$(I v`UH L$ H L$ H D$0H D$8H L$(H t$ H L$0H D$8H T$@H vdUH D$0H vjUH vhUH vgUH |$xD |$xH \$`H L$hH D$pH T$xL |$HH \$PH L$XH L$pH L$PH L$xH L$XH L$HH L$`H |$`H D$pH \$xH t$hH D$pH \$xH |$`H t$hH v-UH M9,$u L$xL l$HL ..u%H t$xH D$DH t$DH L$hH D$pH D$hM 5]*; D$pL L$`H D$PH D$`M D$PL \$XH L$XH \$ H \$ H v/UH l$ M9,$u v,UH \$(H D$ H v,UH \$(H D$ H vJUH D$HH L$HH =+UB D$@H \$HH L$PH |$XH L$PH |$XH9 \$(H L$PH \$(H |$XH T$ H9 L$ H L$PH T$ H |$XH9 L$ H L$PH T$ H |$XH9 T$ H L$PH T$ H |$XH9 L$ f |$ f vkUH D$8H \$@H D$ H L$8H L$@H =&?E D$ H vTUH t$`H |$XH L$PH \$HH D$@L D$@H \$HH L$PH |$XH t$`L |$ H t$(L |$ H t$(L \$GD L$hH T$hH |$h1 D$`L L$xL D$`H |$hL L$xM L$HL 5#&7 |$hL L$HI \$XH T$XH D$PH D$pH L$PH D$p1 |$ H t$(L |$ H t$(L L$XH D$LH T$LA \$`H D$hH L$`H T$PH T$PH T$PH vDUH D$HH T$`H \$$1 \$0H D$(H L$8H D$(H L$8H \$0H L$(H T$HI L$0H T$8I \$(H L$0H |$(H D$hH \$pH D$hH \$pH L$@H L$HH L$@H \$8H D$ H D$ H \$8H D$(H T$PH D$(H \$0H L$(H T$PH D$(H \$0H D$(H T$PH D$(H \$0H L$(H D$0H L$(H L$(H D$0H L$(H D$(H \$0H v0UH l$ M9,$u vrUH D$0H L$0H v{UH \$HH D$@H D$(H D$@H D$(H \$pH D$PH L$hH T$PI |$8H) L$HK D$(I D$hH T$@H |$8H t$(H L$0H \$HH T$@H L$0f D$hH |$ H |$ H t$(f \$HH D$@H L$PH D$(H D$@H D$(H D$@H \$HH v UH vOUH \$XH L$`H D$8H L$XH |$`1 \$hH D$`H L$pH D$HH T$8H D$0H \$(H L$@H T$8H \$(L D$0@ L$`M D$0H L$@H T$8H \$(L D$HL L$`H D$0H \$HH D$@H L$PH D$(H D$@H D$(H D$@H \$HH v UH vOUH \$XH L$`H D$8H \$`H v6UH \$8H vaUH \$8H D$0H D$0H \$8H v,UH \$(H D$ H \$PH |$`H t$hH D$HH L$XH \$PH t$hH |$`H9= L$XH \$PH t$hH D$HH L$XH \$PH t$hH D$HH L$XH \$PH t$hH |$`H t$0H |$(H L$XH L$PI L$HH T$0I L$(H L$`H |$ H |$ H v{UH D$ H T$ I D$xfD |$@D |$@H \$(H L$0H D$8H T$@L D$HH L$PH D$XH L$PH D$8H \$@H L$HH |$(H T$`H |$(H D$8H \$@H t$0H L$HH D$8H \$@H L$HH |$(H t$0H v-UH M9,$u L$@H L$@1 D$hH L$XH T$PH T$PH t$XH9 T$PH D$hH T$PH L$`H \$HH T$PH t$X1 T$PH t$XH \$HH L$`H D$hH v3UH v/UH v{UH D$8H D$8H vMUH |$PH vMUH |$PH vMUH |$PH \$HH D$@H \$HH D$@H \$HH L$P1 D$@H |$X@ t$`H \$HH L$PH T$'H D$(H L$@H T$PH T$HH T$HI t$(L T$XH D$`E T$(H D$&H D$@1 T$(H T$(H D$(H |$ @ t$(f |$pH \$`H D$XH L$hH |$pH L$0H \$@H |$8H D$(H D$(H L$0H \$@H |$8H L$`H T$XH T$XI t$8I T$0H \$XH t$@I \$`H D$XH L$0H \$@H |$8H D$(H D$(H L$0H \$@H |$8H L$`H T$XH T$XI t$8I T$0H \$XH t$@I D$XH D$@H L$@H \$8H D$(H \$8H D$(H \$8H D$(H \$XH t$8I T$(H \$X1 D$0H L$ H D$ H \$0H \$XH D$PH D$ H \$0H D$ H \$0H \$PH D$(H \$8H D$(H \$8H \$0H D$(H \$8H \$8H D$(H L$XH L$PH L$PI T$8I L$(H D$hH L$0H D$@H L$H1 \$8L t$0H9 \$hH L$pH t$0I \$8H L$HH D$@H \$PH L$pH T$hH T$hI t$HI T$8H \$hH L$pH |$xH D$`H L$hH \$`L \$`I D$pM D$@H L$xL \$HH D$8H L$8H T$HI \$xH D$hH t$hL t$hL u6L9 L9K8u$L I@L9K@u \$x1 t$hH L$`H \$8H 5}#M D$`H L$`H \$8H 5:#M L$`H \$8H tFH9 L$`H \$8H L$`H \$8H 5n"M tFH9 L$`H \$8H 5""M L$`H \$8H L$hH |$xH L$hH |$xH T$hH T$hH u4H9 L9C8u$L A@L9C@u \$x1 t$hH9 u3H9 L9G8u#L C@L9G@u t$hL L$xL D$@H L$xL \$HH t$hH t$PL \$xH D$hH L$XH D$hH L$XH D$@I9 D$@I9 L9N8 K@L9N@ \$pH \$pH L$P1 L$HH T$hI9 L9X8 [@L9X@ \$xH \$x1 L$`H \$XH T$XH L$XH L$PI L$`f T$XH T$XH D$ H \$0H D$ H \$0H L$PH \$X1 \$XH L$PH L$PI T$0I t$ H D$8H T$(H D$(H \$8H D$8H L$8H L$8H D$ H t$8H D$81 voUH \$0H T$(H |$0f L$,H HcL$@H v%UH M9,$u t$HH L$PH t$HH L$0H D$(H D$(H L$0H D$8H T$XH D$8H \$@H L$8H D$@H L$8H D$8H \$@H D$8H \$@H v%UH M9,$u |$hH D$ 1 D$@H T$PH D$XH T$PH L$xH \$HH L$HH L$xI L$hH D$pH D$HH \$xH D$HH D$HH \$xH L$HH L$xI D$hH D$hH \$pH \$@1 L$`H D$8H L$8H L$`I L$hH D$hH \$pH D$hH D$hH \$pH \$pH D$hH D$hH \$pH v%UH M9,$u |$(H \$@H D$8H L$8H T$@I D$(H D$HH D$0H D$HH v6 5^=6 E D$HH t$xL T$?D T$>H t$xH l$0A T$8H D$pI T$@H D$pI \$>H t$xI T$pI \$XI \$hf D$`H t$PH T$hL T$`L9 T$@H T$hL T$@L9 t$xH |$ H t$(L D$0L |$ H t$(L D$0L \$(H9 |JH9 |)H9 |TH9 \$(H9 |TH9 \$(H l$PL |$HH l$xN \$pN \$hN \$`H D$XH t$xL D$PL L$pL D$PH t$hL D$HL L$`L D$XL l$PI L$@H |$ H t$(L |$ H t$(L \$(L9 \$0I) D$hH L$xH \$pI) D$HI T$PI T$@H T$@H D$hH L$xH \$pH D$HL T$PH T$8L T$8I T$hL \$pH L$xH |$ H t$(L |$ H t$(L \$(H P 8S u] \$ H L$(H \$xH D$XH T$P1 @@L9 t$@L D$HL T$xH T$PH t$@L D$HI D$XH \$xL D$XH T$PH \$xH D$XH T$PH \$xH \$xH T$XL D$P1 D$HH L$@D T$xH L$@H T$XL D$PI D$HH \$xL D$HH L$@H T$XH \$xL D$HH L$@H T$XH \$xL t$(L t$(L D$ H D$ H t$(L t$0H |$ 1 t$0H |$ H9 \$XH L$`H |$hH t$pL D$xL L$pH9 D$(H t$pL D$xH D$hH D$0H T$pH \$0H t$ H L$(H t$pM L$ H L$0I T$8H D$(H |$ H t$(L D$0L |$ H t$(L D$0L D$H1 L$@L T$PH L$pL L$@H D$HL L$pL T$PA D$HL T$PA D$hH L$xH T$xL T$xI L$hH t$HL D$@L D$XH L$>H \$`H M9\$ L$ M \$XL L$>H \$`H t5M9i t$XH D$XH D$XH L$>H |$ H |$ H v/UH l$ M9,$u D$ H \$(H L$0H D$ H L$ H T$(H |$PH \$pH L$ H L$ H T$hH \$pH t$@H L$HH L$@H L$(H D$hH L$hH T$PH T$PH v/UH l$ M9,$u vMUH vNUH vNUH vMUH D$P1 |$ D |$0H L$ H |$ D |$0H L$ H |$ H t$(L |$ H t$(L 0r>A |$@D |$PD |$`H D$@H \$HH L$PH D$X& |$@D |$PD |$`H D$@H \$HH L$PH \$@f |$@D |$PD |$`H D$@H \$HH L$PH t$ H D$(' L$0H D$`H t$ H L$0H D$`H |$@D |$PD |$`H D$@H \$HH L$PH |$ H t$(L D$0L |$ H t$(L D$0L vmUH t$H |$XL L$>H L$XH L$XH t$HL D$PL \$=H D$hH E8l$ T$ L9 L$PH D$HL l$>L L$PH D$HL \$=H D$hH A L9 L$@H D$HL T$`L l$XD \$=H |$ H t$(L |$ H t$(L v/UH l$ M9,$u D$PH L$`H |$hH t$pH D$PH L$PH T$XH T$0H \$hH \$8H t$pH t$ D D$`D O H9 |$(H T$0H \$8H t$ H |$(D L$(H |$ H |$ H |$PH \$pH L$ H L$ H T$hH \$pH t$@H L$HH L$@H L$(H D$hH L$hH T$PH T$PH v/UH l$ M9,$u |$hH D$PH \$XL t$ L @ L9 \$XH t$ H |$8L \$xL \$XH t$ H |$8L L$PH T$0L D$(A8J t$ H |$8L D$(L \$xL t$ H |$8L T$0f L$0H |$ H t$(L D$0L |$ H t$(L D$0L S(H9P(uWH D$(H \$0H T$0H T$(H T$0H T$(H \$7H |$XH L$7H t$XI L$7H L$pH T$xH \$XH D$PE1 D$pL L$xD D$`L L$`H D$hH L$HL T$@L \$8L L$7H \$XH D$PL L$HL T$@L \$8L vbUH \$ H \$ H \$PH L$HH D$pH L$PH L$HH T$pI D$XH D$@H T$XL T$XI D$hH D$hH D$@H \$`H R0H9 D$ H T$ H \$xL T$@L L$HH D$7H \$XH |$PH L$8H T$@H \$XH |$PL L$HH D$7H v[UH |$0H L$(H L$ H v5UH l$(M9,$u v5UH l$(M9,$u v5UH l$(M9,$u v`UH D$PH D$0H \$8H L$@H |$HH t$PL M9,$u v0UH vMUH vjUH H H9K u6H D$(H \$0H L$(H T$0H9J( v1UH T$(H v0UH vjUH H H9K u6H D$(H \$0H L$(H T$0H9J( vMUH vMUH vJUH D$HH L$HH \$hH D$`H s4fD D$NH D$NH D$`fA s4fD D$LH D$LH D$`fA s4fD D$JH D$JH D$`fA s4fD D$HH D$HH D$`fA s4fD D$FH D$FH D$`fA s/fD D$DH D$DH \$8H t$PfD D$PH D$PH D$PH D$PH D$PH D$PH |$ H |$ H \$pH D$hH L$xH \$pH D$hH L$xH \$pH T$hH L$@H \$8H L$8H L$@I L$6H L$*H T$0H L$XH T$^H L$*H T$0H L$XH T$^1 \$ H L$(H \$ H L$(H H9P0u$H |$,H |$8f t$8f t$8f 8X$u8 H(H9H H9P0u$H D$PH T$PH L$0H \$(H D$8H L$8H T$0I t$(H H9P0u$H |$(H t$(H H9P0u"H t$(H L$(I |$(H L$(I |$ H L$ I 8H9p L$01 8H9p |$0} T$0H9 D$01 D$ H |$PH D$P1 |$@D |$HD |$XD |$hH D$@H \$HH L$PH T$ZM D$\H \$HH L$PH D$@H9 \$8H \$8H |$4H D$@H T$HH D$@H D$@H D$PH \$XH D$PH \$XH |$hH \$PL t$pH L$pH T$HH L$XH T$PH |$hH L$XH sGfD T$PH |$hL \$FL 59e5 T$PH |$hL \$HL \$xH L$`H 5Cd5 L$`H \$xL H(H9 D$0H T$0H D$xH T$xD s"fD 5Xa5 T$xD L$HfA s"fD T$xD L$JL L$LL T$xD L$LI T$Pf T$FL T$Pf |$XH t$`H L$XH T$`I |$ H t$(L |$ H t$(L D$HH t$hH \$PH |$PE1 |$PD L$HfE |$0H D$(H L$(H T$0I D$hH D$0H D$(H L$(H T$0I D$hH D$0H D$(H L$(H T$0I D$hH t$0H D$(H L$(H T$0I D$hH L$0H \$(H L$(H T$0I D$hH |$ H |$ H D$HH |$0H T$0I D$ H |$0H T$0I D$ H |$0H T$0I D$ H |$0H T$0I D$ H |$(H T$(I D$ H 8.uM 5fV5 5P}} \$`L d$hL l$PL 5(U5 D$`L d$hL l$PL |$xH L$pI T$pL D$PH T$HH t$PH T$HL L$pH T$`L9 t$PH T$Hf L$pH D$PH |$xL \$`L d$hI =4z} 55z} \$pH L$xH9 T$FH T$FA 5uR5 L$EH D$`L d$XL l$PL |$ H t$(L |$ H t$(L d$HL \$@f |vL9 D$`L \$@L l$`K 4:I9 |$hL D$xL T$PH D$xL T$PL |$hI L$XH t$hH D$pL \$hH L$XH9 5?N5 |$`I l$@L d$HH |$ H |$ H t$(f s'fD 5"M5 D$FfA T$Df D$`H L$PH |$XH \$HH t$hH L$XH T$hI \$HH L$PH D$`H |$ H t$(L |$ H t$(L t$(H D$Hf L$6H \$HH \$HH \$HH \$HH L$HI D$@f L$,H \$@H \$@H \$@H \$@H \$@H L$@I L$!H \$8H \$8H \$8H \$8H L$8I v[UH D$(H \$0H T$(H D$hH L$xH \$pH L$@H T$hH T$hH L$pH 5Jv5 T$PH L$@I L$@H D$HH L$@H L$@I T$HH L$hH L$pH L$HI L$hH T$HH \$pH L$hI T$HI \$pI L$xH D$@H v0UH l$8M9,$u D$pH \$xH t$xH L$pH L$xH9 T$pH L$xH T$0H t$(1 |$8D |$@D |$PH t$8H |$@H t$HH |$PH t$ H D$XH L$xH T$0H t$(H D$ H9 |$ H |$ H |$8H D$PH L$`H L$`H T$PH \$XH t$(H T$0H t$(H T$PH L$XH T$8H D$&H T$8H D$&H T$8H D$&H D$&H v/UH l$ M9,$u vvUH D$(H \$0H T$(H t$0H9F T$08J l$(H l$(H |$ H |$ H l$(H t&H9 D$p T$pH D$` t$`H D$P? t$PH 5;>~ t$@H t#H9 \$0H |$ H T$ H =(p} =jo} v7UH D$@H \$HH |$XL D$hL |$ H t$(L D$0L |$ H t$(L D$0L D$ H \$(H T$ I D$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$(H L$ H T$(f L$ I T$(I vPUH D$@H L$PH \$HH D$@H \$HH L$PI L$PH D$5L L$5L L$EH T$PH t$hH t$`H t$xH T$XH T$hH T$XH T$`H T$pH T$pH |$hL D$`H D$HH D$HH |$hL |$ H t$(L |$ H t$(L \$`H D$XH D$8H D$@D L$0H D$@H \$`H9 t$XL L$0L D$ H T$ H D$0O T$8K D$8H D$8H \$0H D$hH \$pH L$x@ T$hH D$XH D$8H \$0H L$aH u L9 rZwMD w2r%H |$xH D$`H T$8L L$XL T$@H T$PH D$0H D$PH \$HH L$XH |$`H t$8L T$0H9 |$pD |$xD D$8H |$8H t$hH \$XH t$hH |$`L \$XH D$pH \$xH |$pD |$xD |$ H t$(L |$ H t$(L L$xH L$PH \$HH D$@H \$HH L$Pf t H9 D$@H \$H1 D$@H \$HH \$H1 L$HH |$PH |$xH L$pH \$hH D$`H L$xH T$pf :ipf T$pf :tcu ptEf :tcp4t :tcp6 :udp4f :udp6 T$8H \$pL T$8I \$pI D$HH L$xH L$hH D$HH D$@H \$pH L$xH L$@H |$ H t$(L |$ H t$(L v'UH |$XH |$XH t$`H \$PH L$PH D$xH L$xH T$XH L$`H D$@H \$XH \$HH D$hH L$HH \$hH \$XH L$`H T$XH T$`1 T$XL T$`H T$XH D$`H T$@H \$XH T$XH D$`H T$@H \$XH D$p1 L$XH D$`H L$@H \$XH D$@D D$@H \$XH L$`H D$@D D$@H \$XH L$`H T$XH D$@H \$XH L$`H D$@H \$XH L$`H |$ H |$ H v%UH M9,$u |$xD |$XH |$XH t$`H \$HH L$HH |$pH T$XH D$`H |$XH T$pH \$xH D$PH \$XH L$`H T$XH T$`H D$XH \$`H |$xH T$XH D$`H |$XH T$pH \$xH |$xH T$XH D$`H |$XH T$pH \$xH |$xH L$XH D$`H |$XH L$pH \$xH \$xH D$pH \$xH t$HH t$HH \$xH D$pH9 D$pH \$xH t$HH t$HH |$XH \$xH t$`H D$pH D$pH \$xH |$XH t$`H v%UH M9,$u D$hH t$`H |$XH L$PH D$@H \$HH L$XH T$PH T$PI |$`I t$hH \$@H L$HI |$ H t$(L |$ H t$(L v%UH 8cgu T$ H \$0H D$(H T$ H T$8H T$8H L$ H L$ H 9gotRH 9cgu ot9H L$ H 9gou" 9cgu# T$0H |$@H t$@H |$PH L$HH t$(H t$XH t$@H D$(H \$8H T$0H T$'H T$`H D$(H \$8H D$(H \$8H L$`H t$xH T$hH D$8H L$pH D$xH D$pH \$'H 8ioupA 8planuRA 8andru 8windf T$'H =Um~ t$'@ 8open >binduCH 9fileu D$XH >fileuCH 9bindu D$XH D$XH D$XH T$'H = k~ t$0H t$xH D$8H t$0H T$xI L$'L T$81 D$XH 9solaf |$HI T$xL \$0D d$'L l$8M L$'L t$0L L$PH D$HD \$%D d$#D \$&H :fileu :dnuo sudE |$pH D$h1 D$@H D$(M myhostnaL9 L$(f :mdns L$`H 56g~ T$`H t$&H |$PL ?fileu D$XH T$(H9 t$&H |$PL :dnu ?fileu L$'L T$8L D$@L D$xL D$@M9 >succu >unav notfoundL9 tryagainL9& :retuu t$0A L$PH \$&H D$@D \$%D d$#D l$$L D$HA d$#H t$0E1 L$'L T$8| D$(H \$ H \$(1 T$ H 0r%@ 0r%@ 0r)@ 9w#L D$0H u;1 5qa@ D$0H \$8H D$0H \$8H vwUH vwUH D$XH t$HH |$@H L$PH \$8H D$0H L$PH \$8H D$@H \$HH L$XH |$ H t$(L |$ H t$(L \$`H L$hL D$XH \$`H L$hH L$hH \$`H |$@H T$8H t$0H \$8H D$0H D$0H \$8H T$XH |$ H t$(L |$ H t$(L L$hL L$@H \$8H D$0H \$8H L$@H |$ H t$(L D$0L |$ H t$(L D$0L D$8H \$@H L$HL 9ipt+ ipu3 6u-I 9ipt> 9tcu 9tcp4tY 9tcp6tQ 9udp4tG 9udp6t? 9unixt7 unixgramH9 unixpackH9 9w$O D$ H L$HE L$HL D$ I |$ @ :dialu+L 8unix unixgramL9 unixpackL9 \$`H 8unixt> unixgramH9 unixpackH9 etueH T$`H 9dial T$HH L$HH9 :dial L$pH \$hH L$pH \$hL L$pH \$hL L$pH \$hL t$GI t$GH L$XL l$PH L$xH T$xH T$GL T$GL L$XH \$PH \$PH L$XH9 T$GL T$GL T$GL L$XH \$PH \$PH L$XH9 T$GL T$GL T$GL L$XH \$PH \$PH L$XH9 T$GL T$GL L$XH \$PH T$GL L$XH \$PH \$ H L$(H |$0H t$8L D$@L L$HL T$PL \$ H L$(H |$0H t$8L D$@L L$HL T$PL vvUH |$8H D$8H v7UH \$PH |$`I |$ H |$ H D$`H L$]H L$`H D$`H L$_H D$hH D$hH u0fA tcu'A pu L t$_f t$_@ t$]H t$_@ t$]H T$]H T$]H T$xH D$pH T$\H d$\D8 \$pH d$xI9 D$^H D$^H d$\I d$xH D$\H |$ H t$(L D$0L |$ H t$(L D$0L vvUH \$8H |$HD |$XH L$8H L$XH D$HH D$HH \$01 T$@H D$8H L$8H L$`H \$01 D$@H L$@H |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L v*UH M9,$u v@UH l$ M9,$u v-UH M9,$u L$HL L$@L D$8H \$PD |$xD D$xH |$XD |$hH T$HH T$XH T$xH T$`H T$@H T$hH D$XH \$01 L$8H v%UH M9,$u T$HH \$PM T$HL D$PH \$@H T$HL \$xH D$pH L$pH |$xH D$hH D$hH |$@H L$PH T$PH |$XH \$@H T$XH D$`H D$`H D$`H D$8H L$@H L$8H |$ H t$(L |$ H t$(L |$pD |$`H \$@H L$@H \$0H D$HH D$HH L$@H \$0H D$`L D$.L L$PL T$8L LujL T$pH D$xH \$`H T$pH D$xH \$`H T$pH D$xH \$`H L$XH |$XH T$pH D$xH \$`H |$XH T$pH D$xH \$`H L$hH t$/H L$`H D$pH |$hH \$xH t$PL t$PI L$8L t$`L D$hH |$pH t$`H t$.@ t$/H D$pH L$`H \$xH |$hH t$PL t$PI T$8L |$pH t$`H t$.@ t$/H L$`H D$pH |$hH \$xH D$pH \$xH L$`H |$hH |$ H |$ H t$(f vCUH \$hH |$`H T$`H \$pH L$hH \$pH L$XH \$xH L$XH L$XH \$xf LuLH |$x1 \$`H T$XH T$xH T$xI T$`H T$XH T$xH T$xI |$ H t$(L D$0L |$ H t$(L D$0L v[UH |$8D |$@D |$PD |$`H D$PH )t1H H9r@~ D$XH \$`H L$hH |$pH t$xL D$XH \$`H L$hH |$pH t$xL D$ H T$ H L$ H |$pH T$`H D$PH D$XH D$PH D$@H L$HH \$8H L$@H L$8H L$HI T$pH T$pH T$pH v&UH l$ M9,$u vpUH D$0H \$8H D$0H \$8H \$8H D$0H D$pH D$h1 =FYJ \$`H L$HH L$hH T$pH9 L$hH \$`H \$`L L$XI T$pL L$hH \$`H |$HH t$@H L$XL L$HH \$@H \$@H L$HH9 5-~4 T$PL L$HH \$@H \$`H t$@H |$HL 5v}4 \$`H T$pI L$xH \$pH ~/M9 l$PL \$XH D$@H D$PL L$xH9 \$hH L$`H L$`H \$hH L$xH L$xH :CNAMuj CNAM 8CNAMu)A L$`H \$XH D$PH L$(H L$0H L$ H T$(H \$0H t$PH T$(I \$0I t$PI |$ I D$8H L$XH L$8I L$`f v$UH M9,$u D$xH D$xH v'UH l$ M9,$u 8opti nameservI9 \$`H 5oU4 \$`L 8doma =p-J \$XH L$XH 8lookuTfA upuKH 8searuyfA chupH \$hH D$hL D$xI .t41 D$hL T$xH L$PH L$PL D$hL T$xI L$pH L$pH timeout:H98A timeout:E1 L$pH timeout: 8rotau2f teu*L single-rL single-rL9 equeu single-rH L$pH timeout:I single-r 8use-u vct'H 8usevu 8tcu! trust-adL9 trust-adu' 8ednsu u-I no-reloaL9 du"L no-reloaL 9w L single-r 0r+A 9w%L single-r 9w L timeout:I single-r v-UH M9,$u \$0H D$@H L$0H T$@J D$8H \$(H L$(H T$8I v2UH D$0H \$PH D$(H L$0H \$ H L$ H T$0I \$PH D$(H L$0H \$ H L$ H T$0I D$HH D$HH 5lsJ D$HH 59sJ L$hH D$HH D$HH D$HH L$HH D$@H D$@H D$@H \$0H L$0H D$(1 D$8H D$8H D$8H D$(H |$ H t$(L D$0L |$ H t$(L D$0L \$@L \$8L \$HH T$PD |$XD |$hL T$hL L$XH D$XH \$01 D$@H T$8H D$xH D$@H L$ H L$HH |$8H D$ H D$8H T$HH \$@H \$0f T$HH T$HH T$HH \$0H v1UH l$8M9,$u D$`H t$XH L$XH T$`H D$hH L$xH \$8H |$'H L$PH L$@H L$hH L$0H T$PH L$@H D$HH D$8H L$HH D$(H \$pH \$(H L$pH D$ H \$@H |$8H L$XH T$(H D$0H D$(H T$0H t$8I D$ H \$@H D$XH D$XH L$(H |$ H \$@H L$(H T$@H T$@I t$8I T$ H \$0H T$0I \$hH L$hH D$0H D$PH L$PH 5o^J T$`H D$@H \$xH t$0H |$'H L$8H L$0H T$`H D$PH D$XH D$@H D$HH L$XH T$XH T$HH \$pH D$(H \$(H L$pH v,UH |$pH |$pL |$pL tsH9= D$gH D$pH \$hH |$hH9 .t6H \$xH D$xH .t.H D$xH 5f!4 v-UH M9,$u L$pH D$pH .t.H D$pH L$xH L$xH |$xH v/UH l$ M9,$u \$PH D$HH D$Hf t$@H \$@1 D$6H D$6H D$@H D$@L D$XA D$hA D$xA L$hH |$pH T$XH T$8H T$8H L$XH L$XH T$pH T$8H T$hH T$8H D$6H D$6H |$ @ t$(f v%UH M9,$u \$xH \$*H t$@H T$PH \$*H t$@L \$?H T$XH \$?H |$+D |$/H \$Xf L$`H \$XH L$XH \$.H T$0H \$.L L$-E L$XH \$/H T$8H L$XH T$`1 |$XH L$XH |$XH L$XH =m>J L$HH |$@H \$xH \$@H \$pH L$hL T$`H L$hH T$`H \$pL |$PH L$PH D$XH L$hH L$ H L$0H D$8H L$XHcQ \$ H t$0H T$`H \$(H T$@1 T$8H L$XH T$@H vkUH L$PH \$HH D$@H D$@H \$HH D$@H D$ H D$HH |$0H t$ H L$XH \$PH D$HH L$XH \$PH t$ H D$(H T$0H t$(1 |$ H t$(L |$ H t$(L |$2D |$9D t$YH D$PH D$0L T$0L |$ H t$(L |$ H t$(L D$XH t$xH |$pL \$`H D$XH L$8H L$`H T$8H t$X1 \$0H D$@H T$0H T$@I \$xH =h1J D$pH |$ H t$(L |$ H t$(L veUH L$PH \$HH D$@H \$HH L$PH \$`H D$X1 D$8H \$0H D$@H D$8H D$ H L$XH L$0H L$8I D$(H |$@H D$(H |$ H t$(L |$ H t$(L D$PH t$pH |$hui |$,L L$,M9 T$unix |$0H L$ H L$ H T$0I \$hH \$xH D$HH L$hH \$pH L$hH t$hL L$hH v6UH vnUH \$HH L$PH L$(H \$ H9 L$(H L$@H t$(I T$ H \$HH L$PH L$(H \$ H9 L$(H L$@H t$(I T$ H D$0H L$0H D$`H \$hL L$/H t$@L D$@H T$0H T$hH D$@H T$0H \$8H D$0H L$/H \$8H D$`M D$HH \$/H L$@H |$0H D$/H \$@H L$0H D$HH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L vvUH L$0H D$0H L$0H vDUH |$PH |$ f D$0H L$8H L$8H vEUH vkUH D$(H \$0H L$8H T$(H \$0H D$(H \$0H vMUH D$(H L$8H \$0H D$(H \$0H \$HH L$PH |$ H |$ H |$hH |$hH D$xH \$pL =6VI \$pH \$pL |$hL |$ H t$(L |$ H t$(L vCUH L$PH t$`L L$pL T$xL |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L T$@f \$HH ugM9 v]UH D$PH T$PH T$xH D$hH T$hI D$pH T$hH |$ H |$ H vCUH L$PH t$`L L$pL T$xL |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L T$@f D$xH t$@H |$8H L$0H \$`H D$(H L$xH T$`I L$(H L$xH \$XH D$ H L$xH T$XI L$ H L$xH \$PH L$xH T$PI L$xH \$HH L$xH T$HI |$ H |$ H D$ H \$(H L$ H L$(I \$(H D$ H L$ H L$(I \$(H D$ H L$ H L$(I D$ H \$(H L$ H L$(I \$hH \$xH D$HH L$hH \$pH L$hH t$hL L$hH v6UH vnUH 8udp4t 8udp6 L$XH T$0H t$XI T$0H L$pH \$HH T$PH D$(H t$PH t$PI D$pM T$(H T$HH L$hH T$@H 5ilI t$8H |$`H T$hH T$hI t$`I D$xH |$@H T$8H T$xH D$0H L$8H L$8H vEUH d$pH D$xH T$pL =J;> D$hH T$hI |$ H |$ H vCUH L$PH t$`L L$pL T$xL |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L T$@f vnUH D$0H L$0H vvUH L$0H L$0H vDUH |$PH |$ f 9unixf unixgram unixpackH9 dial T$pH T$pH T$pH t$xI T$pH t$xH T$pH t$xH listuUfA \$hH T$hH \$ H L$(H |$0H t$8L D$@L L$HL T$PL \$ H L$(H |$0H t$8L D$@L L$HL T$PL D$ H \$(H \$(H L$(H D$ H \$(H \$(H L$(H D$ H \$(H \$(H L$(H viUH D$ H L$ H d$`H D$hH T$`L =7,> D$XH T$XI |$ H |$ H vCUH L$PH t$`L L$pL T$xL |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L T$@f v\UH vHUH D$0H D$0H vDUH T$pH D$xH = <> D$`H D$hH \$XH T$`H T$`I t$hI T$XH vCUH L$PH t$`L L$pL T$xL |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L T$@f D$8H L$ H L$8H t$ I L$ H T$ I |$PH \$(H t&Hc L$PH \$(H \$0E \$8E \$@E v\UH \$(H \$(H v|UH \$(H D$(E vBUH T$0H v.UH D$HH \$PH L$XH \$`1 T$HH T$PH T$XH T$`H HcD$ H \$(H L$0H vHUH v8UH \$(1 T$(H .t/H D$@H L$PH |$XH t$`L D$hL L$pH D$hH t$`H |$XH L$PI 9listu:fA L$PH t$`H |$XL T$ H t$(D L$PH L$PH t$`L |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L L$pH \$hH T$hH D$pH |$ H t$(L D$0L |$ H t$(L D$0L v3UH v^UH D$(H \$0H T$0H T$(H D$(H \$0H T$0H T$(H T$(H t$0H9F u_H T$(H t$0H9F0u:H T$(H t$0H9F@t D$(H T$(H H9w8 r@H9w@us rH@8wHuiH JXH9OXu_H T$(H t$0H9F`u:H T$(H t$0H9Fpt v^UH D$(H \$0H T$0H T$(H v]UH D$(H \$0H T$(H t$0H9F D$(H \$0H T$(H t$0f ~(H9z(uuH ~8H9z8uk z@@8~@ua zA@8~AuW zB@8~BuMH T$0H T$(H T$0H T$(H v^UH D$(H \$0H T$0H T$(H vXUH P 9S u P$9S$u d$`D \$GE D$PtrD D$PD \$GD d$FH D$PH \$GD \$FH d$`I D$hH t$XH \$hL9 T$HH \$HL9 |$xH |$pI D$xH |$pL ~?H9 \$GE |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L \$8f t$PL T$hH \$8H L$@L \$8H t$PH \$8H t$PH |UH9 \$8H t$PH \$8H t$PH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L \$8f t$PL T$hH L$@H \$8L \$8H t$PH \$8H t$PH |$ H t$(L D$0L L$8L T$@f |$ H t$(L D$0L L$8L t$`L D$hL L$pH L$PH \$HH |$(I9 D$ H \$HH t$`H |$(L D$hL T$hL L$pH L$PH D$ H t$`L l$(L9 |$HL D$ H L$PH \$HH t$`H |$hL L$pL D$ H L$PH t$`L L$pL T$hL l$(M |$HL D$ H L$PH \$HH t$`L L$pL T$hL |$ H t$(L D$0L |$ H t$(L D$0L |$XL T$PH d$xN d$pN d$hH T$HM D$`H D$XL L$xL T$HL D$XH t$pL D$PL L$hL T$HL D$`L |$XI L$HH |$ H t$(L D$0L |$ H t$(L D$0L t$XL D$`L L$hL T$pL \$xH L$HH \$@I |$pH D$`H |$pH D$XH L$`H t$HL D$hf L$@O D$ H T$xH t$pH t$pH L$HH9 |$@L L$ L9 T$xH L$pH |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L \$0I) |$ H t$(L D$0L |$ H t$(L D$0L D$pH \$xI) D$PI T$XI T$HH T$HH D$pH \$xH D$PL \$XH \$@L \$@I \$xH T$pH |$ H t$(L D$0L |$ H t$(L D$0L D$pL L$xL L$XH L$xH L$XL D$pH t$ H \$0H L$XH \$PH D$pL L$xL L$XH \$PH D$pL L$xL D$0H t$(H |$ I t$(H |$PL L$0N |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L |$xD |$`H D$HH9 D$HH D$HH \$XH T$XH T$HH9 |$xH T$`H D$hH |$`H T$pH \$xH =\s~ \$81 D$@H D$@H D$@H \$XH D$PH T$XH |$xH T$`H D$hH |$`H T$pH \$xH T$pL D$xL |$`H t$hH D$pH \$xH D$pH \$xH |$`H |$`H D$pH \$xH t$hH D$pH \$xH |$`H t$hH |$ H t$(L |$ H t$(L |$ D |$(D |$8H D$ H \$(H L$0H |$8H t$@H |$hH D$PH9 D$PH D$PH \$`H =Rm~ T$`H T$PH9 T$hH D$pH T$@H \$hH D$xH =?l~ T$xH T$xI L$xH \$81 D$HH D$HH D$HH \$`H D$XH =|j~ T$`H T$XH9 T$hH D$pH T$@H \$hH T$@H \$hH L$pH D$@H D$@H \$hH D$@H \$hH L$pH D$@H \$hH L$pH |$ H t$(L |$ H t$(L v{UH D$ H \$(H L$0H |$PH |$PH |$ H t$(L |$ H t$(L |$PH }XI9 |$PH =M[~ |$PH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$(M9 T$H1 T$@M) T$01 T$81 |$`H |$XH t$hH t$`H |$hf =LV~ D$ H \$`H \$XH D$ H T$8H t$XL D$(L |$`H |$hI |$PL d$XH \$`H T$@H t$`L D$(L T$0L d$XL |$`H t$hH |$hI l$PL \$XH \$`H T$HH t$`L D$(L \$XL |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L T$@H T$0H T$8H \$0H L$8H l$XM9,$ v5UH l$(M9,$u L$ H L$ H t$(1 l$@M9,$ v4UH \$ H L$(H |$0H M9,$u v$UH M9,$u v4UH \$ H L$(H |$0H M9,$u v$UH M9,$u v4UH \$ H L$(H |$0H M9,$u v$UH M9,$u M9,$u vNUH \$0H L$8H t(H9 l$(f M9,$u v+UH M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u v@UH M9,$u M9,$u M9,$u v/UH M9,$u M9,$u M9,$u M9,$u M9,$u v%UH l$0M9,$u M9,$u M9,$u v%UH l$0M9,$u |$ H v%UH l$0M9,$u |$ H v%UH l$0M9,$u |$ H vyUH M9,$ l$(M9,$ v%UH l$0M9,$u v&UH \$0H M9,$u l$ M9,$u v/UH M9,$u M9,$u M9,$u M9,$u M9,$u v%UH l$0M9,$u v&UH \$0H M9,$u M9,$u M9,$u v%UH l$0M9,$u |$ H v%UH l$0M9,$u |$ H v%UH l$0M9,$u |$ H vyUH M9,$ l$(M9,$ v%UH l$0M9,$u l$ M9,$u M9,$u M9,$u v%UH M9,$u v%UH M9,$u v%UH M9,$u vIUH D$HH \$PH L$XH t$hH |$ H t$(L |$ H t$(L l$Hf M9,$ viUH S H9P u>H D$(H \$0H T$0H T$(H vAUH H H9K u H(H9K( v|UH D$(H \$0H T$(H t$0H9F \$08S u I!8K! vAUH vbUH D$8H \$@L t$ I D$8H \$@H T$8H \$@H t$ H T$@H t$8H =>,~ D$0H L$@H \$8H L$@H \$8H D$0H D$0H L$@H \$8H L$@H \$8H D$0H D$XH L$hH L$XH D$ H T$`H D$hH t$XH |$ H T$8H \$(H D$0H L$@H D$0H L$@H \$(H t$XH D$01 |$`H |$8H D$xH \$PH L$HH T$8H) L$xH T$PH L$pH t$@H T$0H L$pH T$0H t$@H L$XH T$`H D$XH \$`H L$hH D$XH \$`H L$hH \$@H D$8H T$ L T$ H9 t$8H uBH9 \$(H D$ H r`H) D$0H D$0H ~!vJH D$(H) T$(H D$@H |$ H t$(L |$ H t$(L L$pH \$hH D$`H \$ H D$HH L$ H T$pH t$`H |$h1 \$8H D$8H t$@H T$0H |$(H T$0H9 D$HH |$@I t$(H9 D$ H L$xI) T$hH L$xH \$pH L$pH9 D$hH T$PH D$0H \$X1 T$`H L$PH |$ H t$(L |$ H t$(L T$@H t$HH D$ H t$XH ~CrNH T$XH D$XH t$PL D$`H) T$PH T$@H |$HL D$`A T$hL) D$D \$=L d$H1 t$ L D$0H \$?D d$D \$=L d$HL l$hL |$pI T$xH T$>D \$=L d$HL l$hL |$pI t$ L D$0H L$xH D$xH |$ H t$(L |$ H t$(L |$XH D$@H L$PH t$`H T$PH9 T$`I L$HL9 \$@K D$@H \$HH L$P1 |$ H t$(L |$ H t$(L \$8H D$0H D$0H vWUH D$(H T$(H =zhz \$@H L$HH D$8L t$ H) T$ H9 t$8H v@UH D$`f \$hH L$HH= t$8H T$8H9 D$@H t$hH9 \$HH9 L$ f D$@H L$ H T$8H ~mH9 rNH9 D$0H T$(H D$@H T$(H \$8H \$XH D$8H t$pH |$hH L$`H \$XD uKH9 L$ H D$8H \$XH t$pH |$hD L$ D L$$L \$(L l$0H \$XH t$pL D$8D L$$D \$(L l$0L |$ H t$(L D$0L |$ H t$(L D$0L v*UH \$ H M9,$u v^UH vIUH v`UH M9,$u v+UH M9,$u v,UH v8UH D$@H T$@H D$(H L$ H D$(H L$ H T$@H vwUH \$XH D$PH L$`H D$0H \$XL 5]62 D$0I L$`H \$XH T$0L L$(L T$8K T$(H t$PH T$0H T$8I D$`1 D$XH \$`H D$@I \$`A D$@I D$XL \$XH D$PH L$`H D$0H \$XL D$0I L$`H \$XL T$8H T$0L L$(K T$(H t$PH T$0H T$8I D$`1 \$8H D$0H D$0H vWUH D$ H) L$ H \$@H L$HH D$8H |$ I T$ H9 t$8H L$xH T$xf T$xI L$HH L$PH L$PH T$pH T$pH L$PH T$pH L$PH D$hN T$G1 \$XH 5Q+2 \$XH |$`L T$hH L$PH vbUH D$8H \$@H L$HH D$8H L$HH \$@H \$xH D$pL \$xH \$@H L$pH \$@H9 \$xH T$pL @(L) T$@L T$XM L$@H L$XH L$pH T$HH D$PH T$pH d$HM T$xE T$PM \$8H L$@H T$8H) \$XH T$pM rCH) T$xI |$ H t$(L D$0L |$ H t$(L D$0L \$xH D$p@ |:PL9zH } E1 D$PH L$ H \$HL L$@L d$XH t$8D D$0L l$(H L$ H T$pH \$HH D$0L L$@D d$XL l$(A r:L) |$8H |$8H \$XH D$PH L$`H D$0H \$XL D$0I L$`H \$XL T$8H T$0L L$(K T$(H t$PH T$0H T$8I D$`1 \$XH D$PH L$`H D$0H \$XL D$0I L$`H \$XL T$8L L$0H T$(K T$0H t$PH T$(H T$8I D$`1 vMUH D$@H \$HH L$PH \$(H D$ 1 T$ H L$PH D$@H \$HH D$(H L$(H t$PH D$@H T$(H T$xH L$hH \$01 T$XH9 d$pL \$PL uFH9 L9hHt x8M9 T$HH t$HH L$hH \$0H L$8L T$XL \$PL d$pH t$8H |$HH9 \$(H T$'H D$`H T$0H T$XH D$XH T$0H D$hH \$`H T$XH t$@L l$HM D$'I L$hH t-r=H T$XL |$ H t$(f |$ H t$(f |$hD |$x1 L$PL L$HH T$HH T$xH T$PH T$pH t$8H t$@H T$@L D$8H |$8H D$@H D$hL D$hL D$hL T$hL \$xN l$pM9 \$`L \$PL \$PI L$8H \$`L D$PL d$HL T$HH T$xH T$PH T$pH T$hH D$hL9 T$hH T$hL D$hH T$xL T$PH |$0L T$PH |$0I T$@M D$hL9 T$hH T$hH T$xH D$pH9 |$(L L$XH T$PH T$PH |$(L L$XH L$PH \$HH \$HH \$xH T$PH D$pH T$@M T$@M D$8H \$@H L$H1 T$ D L$HH T$ D D$8H \$@F D$pH D$XI L$HI \$xL t$HH L$0@ |$'L D$XI |$(I L$PH T$(H t$pH D$0J D$'H L$0H D$XH T$xH t$pH L$01 \$8L L$HL d$@L D$XH L$0H T$xH \$8H t$pH L$HL d$@O D$XH \$`H D$@H L$`H T$XH T$XI t$@I D$8H t$ H t$(L T$0H D$8H L$`H T$XH \$ H t$(H D$8H L$`H T$XH \$ H t$(H L$hH \$`H D$X1 D$XH L$hH t$(H D$@1 T$XH t$(H L$ H \$0H T$8H T$0H9 D$ H |$@H T$8L D$PH \$XH D$P1 |$hH L$`1 T$0H t$8H L$`H \$ H D$8H |$hH L$ H9 D$0H D$PH T$(H \$Xf D$XH T$@H L$hH |$8H D$XD uwH9 \$(D T$ H L$hH T$@H D$8D D$X@ |$0D T$$H D$XH L$hH |$0L D$8D D$0H w=Hc \$hH \$0H D$pH L$8H L$@L D$PH) T$@H D$pH \$0H |$8L D$PA T$`H) L$XH L$xH D$(H L$xH L$XH T$`H L$0H) D$xH |$(1 D$xH D$xH T$`H9 D$`H D$XH D$`H |$xH L$pH \$hH D$`M \$hH D$0H D$HH L$0H T$81 t$hH |$`f T$8L \$(H t$ H L$pH T$ H9 D$(L L$0M9 \$HK |$xH d$@M D$HH L$0H \$(H t$ H |$@H9 |$ H t$(L |$ H t$(L D$01 \$8H D$0H T$0H t$81 ~@rWH) |$hf D$hE1 T$XL L$HL T$`H |$PD \$XH D$@M \$HH L$PH9 D$@L \$`N L$PH \$HH D$@M L$`M L$PH \$HH 58&7 t$@I T$HH L$HH D$HH |$`D |$pH D$`L L$`H D$`L9 D$`L D$`H L$xL L$pN D$hL9 L$@H |$0H \$XL |$0L L$@I \$XH L$@L T$8H T$8H T$pH T$@H T$xH T$hH t$HH L$@H \$8H \$PH T$8H T$pH T$@H T$xH T$hH t$HH L$`L d$`M9 L$`L L$`L d$`H t$HH T$(L \$PH L$xL L$pK D$hH9 L$@L L$@H L$@H \$8H T$8H T$pH T$@H T$xH T$hH D$`L9 T$`H T$`L D$`H L$xH T$pH |$(H D$hH9 T$@H T$@H \$pH D$hH |$ H |$ H t$(f |$pD T$hH9 t$LH |$hH L$L9 T$XH9 T$XH9 t$H9 \$PH L$XH9 L$pM9 D$pL D$pL L$pL D$xI9 T$hH T$hI L$XL D$hH \$`H T$`H T$hH t$XH |$PH L$h1 L$hH T$`H9 |$`H L$pM9 D$pL D$pL L$pH D$xH9 D$DL D$xL L$pI D$DH D$xH D$(H t#@ D$(f D$0D |$PD |$`H D$PH T$PH9 T$PH T$PH L$hL D$`H D$XH9 D$HH D$HH L$HH \$@H D$pL \$xH T$@H T$`H T$HH T$hH T$pH T$XH T$(H L$HH \$@H D$xL T$@H T$`H T$HH T$hH T$xH T$XH T$(H t$0H \$`H D$XH9 T$PM9 L$PL L$PL T$PL L$hL \$`J D$XI9 \$HL D$xH L$8H D$xL \$HI ar @ |$xD D$PD D$GH9 L$xH T$xM9 L$xL L$xL T$xL |$HH T$pL \$`L T$pH |$HL \$`I L$`L d$XK T$XH T$`H D$PH D$GH T$xH T$xL L$xH D$GL L$xI D$PH D$xH T$xI9 T$xH T$xH T$`H |$XH \$hL T$`H |$XI \$hL D$`H L$XH T$`H T$XH Ar @ |$xD D$PD D$GH9 L$xH T$xM9 L$xL L$xL T$xL |$HH T$pL \$`L T$pH |$HL \$`I L$`L d$XK T$XH T$`H D$PH D$GH T$xH T$xL L$xH D$GL L$xI D$PH D$xH T$xI9 T$xH T$xH T$`H |$XH \$hL T$`H |$XI \$hL D$`H L$XH T$`H T$XH D$8H \$@1 L$@H9 D$ H L$ H t$8H L$@H t$8H L$HH \$@H D$81 D$8H L$HH \$@H T$ H9 |$ H D$8H L$HH \$@H r$H) L$@@ |$HH \$8H D$0H t$8H D$0H |$HH L$@H ~=H9 T$@H T$H8 D$pH |$ D |$01 D$@H |$XH T$(H L$PH |$XH D$(H L$PH D$(H \$ H D$pH |$ D |$01 D$8H |$PH D$8H |$PH L$HH L$HH L$ H D$8H \$ H D$(1 r[H) r)H9 D$PD |$hD |$xH |$PL L$@H \$8H T$8H T$xH T$@H T$pH D$0H T$HH |$PL D$0H \$(H D$(H |$PL T$(H D$0H |$PL d$hK L$hL L$hL T$HL l$xO t$pM9 \$@H \$`L l$8H \$@L l$8H \$`L d$@L |$8H T$8H T$xH T$@H T$pH D$hL9 T$hH T$hL D$hH T$xH D$pH9 T$@H T$@H T$hL D$hL9 T$hH T$hH T$xL D$pL9 T$PH |$HH \$XL T$PH |$HI \$XH L$PL D$HH \$HH \$xH T$PH D$pH |$ H t$(L D$0L |$ H t$(L D$0L D$hH L$x1 s/E8 p A8 \$8H D$PH D$0H T$HL D$PH \$8M |$(D L$0H9 t$HH |$(A D$PA9 T$@D D$PH T$@H \$8H |$(L v7UH v`UH T$ H T$(1 T$ H l$@M9,$ v`UH l$ M9,$u v?UH |$XD |$hD |$xH T$XH T$`H T$hH T$pH D$xH = u} T$@H D$PH \$HH D$PH T$@H \$HH |$ H |$ H vqUH P 8S u@H P(H9S(u6H D$(H \$0H T$0H T$(H vM9 |$ H |$ H t$(f |$xE1 >s$I t$xH \$xH L$`I |$`M9 L$pH \$hH L$pH \$hH t$xL D$ H \$(H L$0H |$8H t$@L D$HL L$PL T$XL \$`f D$ H \$(H L$0H |$8H t$@L D$HL L$PL T$XL vuUH |$pH D$hD |$ H |$ H t$pH =aDz t$pH =*8| L$hH L$hH T$PH L$hH L$PH D$xL t$pH T$ L L$(H D$0H L$xH9 T$HH L$xH |$HH |$`H L$XL D$xH L$XH |$`L \$hH D$xH L$`1 D$pH |$xH t$hL D$`L |$xH t$hL D$`H T$pH D$xH \$hH L$`H |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L T$`H T$`H T$hH T$hH |$pH \$xH \$xH |$pH D$ H \$(H L$0H |$8H t$@L D$HL L$PL T$XL D$ H \$(H L$0H |$8H t$@L D$HL L$PL T$XL L$HH L$HH L$HH t$@H D$hH T$hH L$PH L$PH9 \$`H D$pH L$XH D$pH L$XH \$`1 L$HH9 |$ H t$(L D$0L |$ H t$(L D$0L D$@H T$xH D$@L D$hH t$`H D$(L t;I9 L$ J L$ L \$@K T$`H t$hH |$(H L$xH D$hI |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L L$pH T$xH L$ H L$(H L$pH L$hH L$`H T$`H T$`H \$PH L$ H D$(H D$hH d$8H D$`J D$`L L$PH D$`A L$XH L$PH D$`L d$XI d$XL |$HH d})L T$xL T$xL D$XH9 L$PH T$`H L$ H T$(H D$hH D$0f T$`H9 L$XH D$ H \$(H L$0H |$8H t$@L D$HL L$PL T$XL D$ H \$(H L$0H |$8H t$@L D$HL L$PL T$XL T$PH D$`M L$pI T$xM \$XL D$`H |$xH L$PL L$pL D$XL |$ L l$(L T$0H L$pH9 \$@H \$hL L$ L T$(H t$0H L$8H D$xH D$ H L$(H D$0H \$8H D$hH9 D$HL T$xL L$pL |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L L$pH T$pH T$ H T$pL D$xH D$xH T$pL |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L T$ H L$xH L$xH L$ H T$(H D$0H L$8H D$HH L$ H t$(H T$ H L$pL L$pH L$ H T$(H L$ H T$(H D$0H L$8H L$HH D$ H \$(H L$ H T$(H D$0H L$8H D$HH L$ H t$(H D$8H L$ H T$(H L$ H T$(H D$0H L$8H L$HH D$ H \$(H D$0H \$8H L$@H |$HH t$PL D$XL L$`L T$hL D$0H \$8H L$@H |$HH t$PL D$XL L$`L T$hL D$ L L$8L D$ L L$8L D$ H L$8L D$ H L$8L D$ H L$8I T$@H D$ H L$8I T$@H D$ L L$8H L$@L D$ L L$8L D$ H T$8H x fH H(fH x0fH H8fH B8fI D$ L9 vRUH l$8M9,$u D$HH \$PH L$XH |$`H t$hL D$pL L$xE D$HH \$PH L$XH |$`H t$hL D$pL L$xE L$xH \$pH D$hH L$0H L$hH L$0H L$8H L$PH L$8f D$HL L$xI T$HH T$8H9 D$@L L$0M) T$xI T$@H D$HH D$@H T$hH D$pH \$HH D$HH \$@H L$xH T$hH \$pH |$ H |$ H D$(H \$0H D$@H D$8H D$0H D$(H D$ H L$@H T$8H \$0H t$(H L$@I T$8I \$0I t$(I |$ I D$@H D$8H D$0H D$(H D$ H L$@H T$8H \$0H t$(H L$@I T$8I \$0I t$(I |$ I D$@H D$8H D$0H D$(H D$ H L$@H T$8H \$0H t$(H L$@I T$8I \$0I t$(I |$ I D$@H D$8H D$0H D$(H D$ H L$@H T$8H \$0H t$(H L$@I T$8I \$0I t$(I |$ I D$pH \$xH \$xH D$8H |$PH L$xH \$PH L$XH D$HH T$@H D$@H D$8H L$pH D$8H L$pH D$8H D$8H D$PH \$XH D$XH L$PH L$`H T$PH |$0H D$ H \$`H T$PH D$PH \$XH D$(H \$0H L$(H L$0H D$0H D$0H |$hH D$XH |$HH D$0H D$(H D$0H \$(H D$PH \$XH L$`H |$hH \$XH L$`H |$hH \$PH L$XH \$PH L$hH D$XH D$8H D$hH \$XH L$`H |$8H t$hL D$pI |$ H |$ H T$pH |$pH T$hH |$hH T$`H |$`H L$XH |$XH L$PH |$PH L$HH t$HH L$xH T$xH L$@H t$@H T$8H |$8H |$ H t$(L D$0L |$ H t$(L D$0L L$PH \$pH \$pH T$8H \$pH L$PL T$8H T$HH L$@L \$`I L$@H T$HL \$`H D$hH \$hH \$hH D$XH D$XH \$XH \$XH \$XH \$XH D$xH D$xH \$xH \$xH D$hH \$xH L$XH |$hH |$XL D$xL L$HD \$@I D$PH L$HH \$@D T$?H |$PH |$ H t$(L |$ H t$(L vjUH D$@H |$XH L$PH \$HH L$PH D$@H |$HH t$PL D$xD |$ D |$0D |$@D |$PH t$ H T$(H t$0H T$8H t$@H T$HH t$PH T$XH T$ 1 T$`H T$`H vOUH S8H9P8u D$(H T$0H T$(H L$pH D$`H \$hH |$xH L$pH T$hH \$pH L$`H L$8H L$8H L$0H D$@H T$8I L$pI T$@H L$xH T$8H9 D$HL L$0L) T$pI T$HH D$@H |$ H |$ H L$`H D$PH \$XH D$8H \$0H L$(H T$PH T$XL \$8H L$0H |$(H T$XH |$ H |$ H D$@H \$HL L$pH t$`L D$hH D$(H T$HH D$@H L$`H |$hH T$HL \$(H T$HH |$ H t$(L D$0L |$ H t$(L D$0L D$pH T$0H |$P1 \$PH L$XH L$0H9 T$pH D$@H L$0H L$0H D$8H D$8H L$0H t$HH |$PH |$ H |$ H D$8H \$@H t$XL D$`H D$ H T$@H D$8H L$XH T$@H \$ H t$@H |$ H t$(L |$ H t$(L \$0H D$`H L$8H D$hH D$hH L$HH L$HH D$8I9 L$@H D$XH T$HI L$`J T$XH L$0H T$HH9 D$PL L$@L) D$8M) T$`I T$PH D$XH @(L9 D$pH \$xH T$ H L$0H T$0H L$ H D$XH \$@H t$8H |$PH D$XH L$ H T$0H \$@H t$8H |$PL \$(H t$HH D$XH T$0H \$(H t$HH D$pH T$xH \$XH |$0H vlUH v1UH \$@H l$8M9,$u v1UH \$@H l$8M9,$u v7UH |$`M |$ H t$(L |$ H t$(L l$HM9,$u v/UH |$ H |$ H l$@M9,$u v)UH M9,$u M9,$u v1UH \$@H l$8M9,$u v1UH \$@H l$8M9,$u v7UH |$`M |$ H t$(L |$ H t$(L l$HM9,$u v/UH |$ H |$ H l$@M9,$u v)UH M9,$u M9,$u v1UH \$@H l$8M9,$u v1UH \$@H l$8M9,$u v7UH |$`M |$ H t$(L |$ H t$(L l$HM9,$u v/UH |$ H |$ H l$@M9,$u v)UH M9,$u M9,$u v1UH \$@H l$8M9,$u v1UH \$@H l$8M9,$u v7UH |$`M |$ H t$(L |$ H t$(L l$HM9,$u v/UH |$ H |$ H l$@M9,$u v)UH M9,$u M9,$u v1UH |$ H |$ H l$@M9,$u v+UH M9,$u M9,$u v3UH l$8M9,$u v9UH |$ H t$(L |$ H t$(L l$HM9,$u v3UH l$8M9,$u sha H T$0H v=UH \$ H v;UH v;UH v;UH v;UH |$xH \$hH D$`1 r'fA T$DH L$HH T$DI D$`H L$HH |$ H t$(L |$ H t$(L v,UH v,UH \$XH L$ H \$XH L$0H \$XH D$PH \$`H L$hH D$XH L$(H L$hH \$`H L$8H L$hH \$`H D$XH uHHc L$xH \$pH D$hH L$8H L$xH \$pH L$HH L$xH \$pH D$hH D$0H t$pH L$pH T$h1 |$hH D$xf T$0H T$0H T$0H D$0H D$PH T$0H t$(H \$ H D$8H L$(@ \$ H t$0A |$ED |$HH L$xL L$pL T$pH T$xH D$hH D$hH |$XL |$XL D$hH D$E1 T$xH \$`H T$xI D$Xf L$hH \$`H D$XH L$(H D$0H D$XH \$`H L$h1 P}>I D$0L D$0I D$0H \$(H L$8H L$0K T$ H D$XH L$hH D$ H T$(I9 D$0H \$(H D$(L9 D$x1 |$ H9 L$HH D$P \$ H L$8H L$XH \$ H L$(H \$ H |$ f D$`H \$8H L$`H \$PH D$HH L$pH |$@H t$hL \$0H D$XH T$8H9 T$8D |$xD D$`H L$xH D$XH L$pH D$HH \$PH D$HH \$PH \$PH D$HH D$HH \$PH L$pH |$@H t$hH D$XH \$0H \$HH |$@H D$8H \$(H D$PH T$0H9 D$@H T$0D |$`D |$pH D$XH L$`H D$hH D$PH L$pH D$xH D$8H \$HH D$81 D$ * L$FH L$FH |$HH |$H1 T$HA \$'f T$HD \$'I T$@H9 l$8H \$@1 |$'H t$8L D$HH |$8H \$@1 |$'H t$8L D$HH D$@H \$8H \$@1 |$'H t$8L D$HH |$'H D$HH |$8L l$0M l$0H |$(H L$`H D$h# \$@H |$'H t$0L D$HH L$pH \$@H |$'H t$0L D$HH \$@H |$'H t$0L D$HH L$PH \$@H |$'H t$0L D$HH |$ f D$nH L$o1 t$xH t$xL T$oL T$oD8 $1L9 L$xL9 t$pH D$ H |$ H t$(L D$0L |$ H t$(L D$0L D$ H D$ H |$~H D$~D =Rl{ D$ H D$ H D$8H \$@H L$HH |$PH t$XL D$`L D$8H \$@H L$HH |$PH t$XL D$`L v]UH D$`H T$8H D$8H \$@H D$8H \$@H D$8H L$8H L$8H L$pH D$ H L$pH L$xH D$hH L$hH =YT{ T$xI |$ H t$(L D$0L |$ H t$(L D$0L |$PD |$`D L$8H optionalH9 explicit explicitH90uf D$`H L$8H optionalH explicitH explicit optionalH explicitH generaliL9 generaliH 8utu 8iau u'I printabl printablH 8numeu 8utf8u default:L9 default:E1 8tag:A 8seu applicat iouz D$`H L$8H optionalH explicitH |$0I generaliI printablI default:I applicat applicat 8priv atu| D$`H L$8H optionalH explicitH |$0I generaliI printablI default:I applicat u/I omitempt omitempt D$ H D$`H L$ H L$8H optionalH explicitH D$(H D$XH L$(H L$8H optionalH explicitH D$8H D$8H \$0H D$(H \$0H9 D$(H \$0H9 D$(H D$(H \$0H9 D$(H \$0H9 D$(H \$0H L$(H L$(H \$(H v`UH D$0H |$HH9 \$8H \$8H |$ H t$(L |$ H t$(L v`UH D$0H L$@H9 \$8H \$8H |$ H |$ H t$(f v[UH D$01 D$XL t$xH |$p1 \$0H L$ H D$@H T$8L L$(M T$(H T$@H \$0H t$ H t$pL D$xL |$pL |$ H t$(L |$ H t$(L v[UH D$01 D$xH t$HH D$hH T$pH L$@H D$xL L$@H T$pH \$HH D$hH L$`H D$XH L$`H |$XH T$xH T$xL ~}I9 D$`H T$xH t$PH T$xH t$PH |$XL D$`L |$ H t$(L |$ H t$(L vBUH D$ H L$ H D$0H \$8H |$HH L$@H T$0H L$@H9 T$0H |$HH) D$8I T$`H L$0H T$`H T$`H t$0H D$(H |$XH L$ I L$ H |$XL D$(H L$HH \$8H D$hH D$xH D$hH \$8H t$xH L$PH \$@H D$xH D$pH \$@H t$xH =m>{ D$hH t$`H |$GL |$GL D$h@ D$hD T$hH D$`H t$XH t$XL D$`L L$hH L$PD T$FH D$hL L$PD T$FL \$`H |$ H t$(L D$0D |$ H t$(L D$0D D$8H t$XH L$ H L$ H |$ H t$(L D$0L |$ H t$(L D$0L D$ H T$hH L$PD T$GH L$PD T$GL \$hH T$XL L$`I T$HD \$FH T$XL T$HD \$FL d$`I |$ H t$(L |$ H t$(L D$01 vxUH L$hH L$@H \$8H D$0H |$0H t$8L vxUH L$hH L$@H \$8H D$0H |$0H t$8L D$`H |$XH t$PH L$HH t$@H t$@H L$HL L$HH t$@H t$@H L$HL |$XH t$PL L$hH D$p |$ H t$(L |$ H t$(L D$pH |$hH t$`H |$XH L$PH t$HL \$@H t$HH |$XL \$@H L$PL |$hH t$`L L$xH |$ H t$(L |$ H t$(L L$pL L$pI \$HH |$XI L$hH T$HH T$XH9 \$`L L$hH \$`I L$hI \$@H |$PI \$@H L$PH9 \$@H D$PI9 g}SH \$@H D$PH \$@H T$xH 5d~/ T$xL |$ H t$(L |$ H t$(L 5fYF H95& H95Y H95) (|:H dr)H D$ H t$xH L$xH D$ H D$8H \$@H D$8H \$@H r H 5mHF r H D$hH D$hH D$`H D$`H L$OH L$OH |$P1 D$Xf D$ H D$xH T$p1 t$XI L$OH L$xL |$pA T$X1 L$OH L$OH |$PA L$OH D$8H \$@H D$8H \$@H D$pH \$xH T$pH \$hH T$`L L$HH D$ H D$`H \$hH D$PH D$XH L$PH |$XH \$XH vsUH D$(H \$0H T$(H t$0H9F d$`D \$GE d$FE \$GD d$FH \$GD \$FH d$`I D$hH t$XH \$hL9 T$HH \$HL9 L$xL L$pM D$xH D$PL \$GE |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L \$`f \$@H L$hH \$`J L$8M9 L$hH \$`L \$@L d$0D d$0M L$hH \$`L \$@L d$0D L$8M9 L$@J L$hH \$`L \$0D \$0M \$@J L$hH \$`L \$0D L$@H |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L \$`f \$@H L$hH \$`J L$8M9 L$hH \$`L \$@L d$0D d$0M L$hH \$`L \$@L d$0D |$ H t$(L D$0L L$8L T$@f |$ H t$(L D$0L L$8L L$xH \$pL D$@H L$xM T$HH T$HM9 D$@H L$xH \$pH T$HD \$0I d$xH L$HL \$0M \$PJ L$PL T$pO L$HH \$pH d$8I L$HL d$8M \$PJ L$PL T$pO L$HH \$pH |$ H t$(L D$0L |$ H t$(L D$0L |$XL T$PH d$xN d$pN d$hH T$HM D$`H D$XL L$xL T$HL D$XH t$pL D$PL L$hL T$HL D$`L |$XI L$HH |$ H t$(L D$0L |$ H t$(L D$0L t$xL L$hH \$`M D$xH T$hL l$`O D$@H L$0H D$0H L$hH9 \$`O l$@L9 D$8H D$8H |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L \$8I) L$@L D$@H |$ H t$(L D$0L |$ H t$(L D$0L D$pH \$xI) D$PI T$XI T$HH T$HH D$pH \$xH D$PL \$XH \$@J \$@I \$xH T$pH |sH9 |$ H t$(L D$0L |$ H t$(L D$0L L$xH L$xL t$HL ,qH9 \$8L d$PH t$0M L$xH \$pH t$0L L$xH \$pH t$0L \$8J d$PL \$HM \$@J L$@L T$pO l$PO |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L v{UH |$0H L$(H L$ H |$(D |$0D |$@D |$PD |$`H L$(H L$ H |$(H L$(H L$ H v|UH L$ H L$ H L$(H L$ H |$0H L$(H L$ H |$(D |$8H L$(H L$ H v5UH l$(M9,$u \$(H l$ M9,$u M9,$u v@UH M9,$u v@UH M9,$u vuUH \$@H L$ H L$ H l$8M9,$ M9,$u vuUH \$@H L$ H L$ H l$8M9,$ M9,$u vMUH l$@M9,$u vkUH l$0M9,$u vMUH l$@M9,$u vkUH l$0M9,$u \$(f l$ f M9,$ M9,$u \$@H t$ H t$ H9 M9,$ M9,$u vMUH l$@M9,$u v5UH l$(M9,$u vIUH v{UH D$0H \$81 \$8H D$0H v{UH D$0H \$81 \$8H D$0H vyUH T$/H L$hH T$XH H9P }TH T$XH \$0L D$XH L$hH t$/A T$@H T$XH vuUH \$HH |$ H T$HH t$PH |$HH T$ H T$8H T$@H T$hH t$pH |$hH T$(H T$XH T$`H t$XH L$0H L$0H L$0H L$0H \$hH |$@H t$@H |$8H t$0H T$8H t$@H L$01 D$HH T$hH T$hH T$hL T$hH T$hH \$HH |$ H L$ f L$ H \$(H L$ H \$(H t$HH \$HH |$ H L$ f \$H1 \$HH |$ H L$ f \$H1 \$HH |$ H L$ H \$H1 \$hH |$8H L$8H L$(H D$HH D$0H P}[H t$HH t$HH t$HH D$ H D$0H D$ H L$(f T$(H9 L$hH |$pH \$hH L$pH D$`H \$HH \$XH D$PH T$HH9 L$PH L$XH \$xH D$hH \$PH L$hH \$`H D$XH L$pH T$PH9 D$XH \$`H L$pf \$`H D$XH D$XH \$`H L$pH \$HH |$ H T$ H t$ H |$(f L$HH vCUH L$H8L$'u vAUH L$'1 L$H8L$'u vEUH vEUH T$xH t$xH T$hH T$pL L$hM L$PH \$`H T$8H \$`H L$PH |$8H D$XH |$HH L$@I L$@H |$HL D$XH |$ H t$(L D$0f |$ H t$(L \$/H D$HH T$HH H9P }NH T$HH \$0L 5< / D$HH t$/A \$.H D$HH T$HH H9P }MH T$HH \$0L D$HH t$.fA \$,H D$HH T$HH H9P }MH T$HH \$0L D$HH t$,A \$XH D$PH L$`H \$XH T$PH L$`H H9P }RH T$PH D$0L D$0I L$`H \$XL T$8H T$0L L$(K T$(H t$PH T$0H D$8I T$ H vqUH D$`H L$pH |$xH T$8H T$`H D$HL |$hI T$`H D$HH L9B }SH T$`H D$0L |$hL D$0I D$HL L$@H \$0H L$(K T$0H t$`H T$(H L$@I L$`H L$`H T$8H T$hH \$xH T$`H B8H) \$0H t$(H T$HH D$XL |$0I T$HH D$XH L9B }SH T$HH D$@L |$0L D$@I D$XH L$@H \$8L L$PK T$8H t$HH T$@H T$PI t$0H <0H9 T$HH t$0H t$(H |$`D L$`H D$hH L$HH L$pH D$xH vHUH \$0H L$8H D$(H L$8H L$(H L$8H T$(H t$8H9 vmUH L$hH D$XL t$xH |$pH L$hH D$@L D$@L D$@L D$@L L$hH |$XH t$`L D$pL L$xL D$hH \$XH L$`H |$pH t$xL L$hH |$XH t$`L D$pL L$xL L$hH |$XH t$`L D$pL L$xL L$hH |$XH t$`L D$pL L$xL |$ H t$(L |$ H t$(L |$ H |$pD |$xD L$pH D$xH D$ E1 L$0H D$PH9 L$(L T$8I) |$ H t$(L |$ H t$(L vXUH D$HH t$0H t$ H D$HH \$0H L$ H \$PH L$(H |$0H T$HH D$hH |$0H T$hH \$HH H9P }^H T$hH \$HH T$@L T$@H |$0I D$hH \$HD T$/E T$hH \$HH H9P }OH T$hH T$@L T$@H |$0I \$HH L$@L D$8L L$PI T$8H t$hH T$@H D$PI D$`L |$xH L$pH \$hH D$HL D$HL D$HL D$HL L$`H |$hH t$pL D$xL D$`H \$hH L$pH |$xH L$`H |$hH t$pL D$xL L$`H |$hH t$pL D$xL L$`H |$hH t$pL D$xL |$ H t$(L D$0L |$ H t$(L D$0L |$8H |$ H |$hH D$HH \$PH L$XH D$HH D$`H D$`H |$8H |$ H L$0H \$8H T$@1 D$0H \$8H t$ H L$@L D$(E1 D$hH \$pH L$xH L$xH @(L9 L$(H T$(H D$PH \$8L D$0L L$HL D$PH T$(H \$8L D$0L L$HL T$xM \$ L D$@L D$PH T$(H \$ L D$@L |$xH D$`H L$pH \$hH \$0H t$hH9 T$pH9 L$8H D$HH t$8H L$@H |$`L T$HH L$@H \$0H) T$HH |$ H |$ H D$@H L$8H \$0H D$xH |$hH L$@H L$HH L$0H L$PH L$8H L$XH D$HH D$`H D$`H \$x1 |$ H t$(L |$ H t$(L L$PH D$@H L$PH |$PH D$hH D$hH D$hH T$hH D$PH D$xH T$PH D$pH L$pH \$`H L$XH \$`H |$ H t$(L |$ H t$(L \$hH D$`L |$xH L$pH \$hH D$HH \$@H L$8H D$HH \$@H |$xH D$`H \$hH |$ H t$(L |$ H t$(L t$0H |$xL |$xH t$0L L$@H |$@H D$`H D$pH D$`H D$hH T$@H D$PH \$HH T$@H T$@H L$HH D$XH D$XH |$ H t$(L D$0L |$ H t$(L D$0L D$x1 D$xH T$`H L$PH L$8H D$XH |$8H T$PH L$HH \$0H |$8I t$XD D$@H |$XH t$8I T$@H D$@H \$0H L$HH D$`H D$@H t$8H |$XH \$HH D$`H L$PH |$hD |$xD T$HH T$pH T$PH T$xH T$`H T$hH T$8H T$@H T$XH L$hH |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L \$Hf veUH D$8H \$@H T$8H \$@H D$@H t$8H |$XH \$HH D$`H L$PH |$hD |$xD T$HH T$pH T$PH T$xH T$`H T$hH T$8H T$@H T$XH L$hH |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L \$Hf veUH D$8H \$@H T$8H \$@H D$@H t$8H |$XH \$HH D$`H L$PH |$hD |$xD T$HH T$pH T$PH T$xH T$`H T$hH T$8H T$@H T$XH L$hH |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L \$Hf veUH D$8H \$@H T$8H \$@H D$@H t$8H |$XH \$HH D$`H L$PH |$hD |$xD T$HH T$pH T$PH T$xH T$`H T$hH T$8H T$@H T$XH L$hH |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L \$Hf veUH D$8H \$@H T$8H \$@H D$hH \$pH L$xH D$PH L$HH \$@H L$xH T$hH D$PL L$@L T$HH \$pH D$hH \$pH L$xH D$PH L$HH \$@H L$xH T$hH D$PL L$@L T$HH \$pH D$hH \$pH L$xH D$PH L$HH \$@H L$xH T$hH D$PL L$@L T$HH \$pH D$hH \$pH L$xH D$PH L$HH \$@H L$xH T$hH D$PL L$@L T$HH \$pH D$XH \$`L |$pH =\gz T$XH \$`H t$pL D$xL t$xM L$hH L$hH T$pH \$`H t$xL t$xL |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$XH \$`L |$pH T$XH \$`H t$pL D$xL t$xM L$hH L$hH T$pH \$`H t$xL t$xL |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$XH \$`L |$pH T$XH \$`H t$pL D$xL t$xM L$hH L$hH T$pH \$`H t$xL t$xL |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$XH \$`L |$pH T$XH \$`H t$pL D$xL t$xM L$hH L$hH T$pH \$`H t$xL t$xL |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L vDUH D$8H \$@H L$HH |$PH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L l$8M9,$ v$UH |$ H |$ H l$8M9,$u v;UH D$(H \$0H L$8H |$@H |$ H t$(L |$ H t$(L l$(M9,$u v$UH l$(M9,$u v4UH \$ H L$(H |$0H M9,$u v$UH M9,$u vFUH D$0H \$8H L$@H |$HH t$PH |$ H t$(L D$0L |$ H t$(L D$0L l$0M9,$ v)UH \$8H l$0M9,$u vLUH D$@H \$HH L$PH |$XL L$pH |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L M9,$ v)UH |$XH |$ H t$(L |$ H t$(L l$@M9,$u v%UH M9,$u vcUH D$(H \$0H L$(H \$0H9S I H9K vYUH D$(H \$0H L$(H \$0H9S vKUH vnUH |$@H L$8H D$0H \$8H D$0H \$8H D$81 D$XH \$`u D$XH D$@H |$`H T$@H D$XH9 L$8H \$0H L$8H D$`1 |$ H t$(H |$Hf =^Sz L$ H |$(H t$0L D$8L L$@L T$HL L$ H |$(H t$0L D$8L L$@L T$HL L$ H M9,$ vyUH L$HH T$HH 5q7E O.sNu T$PH L$HH L$PH9 L$HH d$HM |$pH \$XH L$`H9= L$`H L$`H \$XH |$pH9=t L$`H L$`H \$XH |$pH9= L$`H L$`H \$XH |$pH T$hH T$hI \$xH9 \$xH9 \$xH9 \$x1 T$HH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L L$hH O.sNu L$hH L$pH9 T$hf d$hM L$hH L$hH L$XH L$XH9 L$XH9 L$XH D$xH L$PH9 L$PH9 L$PH T$pH D$`H D$`H D$`H D$`H |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L \$@H O.sNu \$XH L$@H |$HH D$PH t$`H \$0H H9=Y D$PH L$8H D$PH L$8H \$0H t$`H |$Hf H9= D$PH L$8H D$PH L$8H \$0H t$`H |$Hf D$PH L$8H D$PH L$8H \$0H t$`H |$HH |$ H t$(L D$0L |$ H t$(L D$0L D$xH T$HL O.sNu \$XH L$HH D$PH \$`H9 D$PH D$PH \$`H9 D$PH \$`H |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L =H9z L$ H D$PH \$XH L$`H D$PH t$pH |$hH \$XH D$PH L$`H D$pI9 \$(H L$(H D$pH D$8H \$0H |$PH T$0H L$(I T$8L t$pL9 \$hH9 \$8H L$(H |$ H t$(L |$ H t$(L L$XH \$PH D$HH t$hH T$HL L$PH D$`L T$hH t$X1 |$0H T$HD D$`L T$hH t$XL L$PD |$ H |$ H vaUH \$(H L$0H D$ H L$0H L$ H T$0H9J vmUH D$HH |$(H L$(H D$0H T$ H T$(H T$0H T$8H T$@H T$HH T$PH T$XH D$`H \$hH L$pH \$ H L$(H L$0H L$8H L$@H L$HH L$`H L$PH L$XH L$hH L$pH =\,z =m+z |$pD |$xD \$hH L$`H \$hH d$hH D$pH \$xH D$pH T$xL D$`H d$hH D$`H L$pH \$xH L$pH \$xH L$hH T$hH L$pH \$xH D$XH H9B D$XH L$XH T$hH L$Pf D$PH T$8H D$PH t$8H t$HH L$@I L$@H t$HH L$hH L$hH T$hH T$hH L$pH \$xH D$pH \$xH vtUH D$0H T$0H D$@H \$HH L$PH |$XH t$`L D$hL L$pH L$@H D$0M D$81 v1UH v4UH |$@H |$HH D$@H |$$D |$0H D$@H \$$1 D$(H \$0H D$(H \$0H D$ H D$ H D$ H D$ H D$ H D$ H M9,$u M9,$u \$(H l$ M9,$u \$(H l$ M9,$u \$(H l$ M9,$u M9,$u M9,$u \$(H l$ M9,$u \$(H l$ M9,$u \$(H l$ M9,$u D$ H D$ H \$(H t$@M $'L9 4:L9 \$xH \$HH T$XL \$@H \$@I \$PL d$8L) T$8H9 T$XL l$HI \$PL d$8H \$PL T$HL D$PH |$ H t$(L D$0L |$ H t$(L D$0L D$XH L$hH \$`H T$8H D$@H L$8H t$`L D$hL L$pH \$@H v1UH \$HH d$(D D$(H D$(H T$(L D$(H T$(D D$(H D$(H ~jvvF D$@H d$ H L$PH \$HL L$PH \$HL d$ H d$(t8vUF D$(H D$(H |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$XH L$hH T$8H D$@H T$`H L$8H D$hM T$8H9 D$@H T$HL l$XL l$HL! l(@D L$GD |$EI |$GI \$EI tJL9 T$xH L$XL T$xH T$pL l$PL) l$pL! l(@D L$FD \$hA \$FA \$ht* T$`H L$PL T$`H |$ H t$(L D$0L |$ H t$(L D$0L vKUH l$8M9,$u D$@H L$PH D$ H L$HL L$@I 8~%L L$HL9 L$@F L$HL L$@I T$PL9 \$(L =>z9 t$HH T$(H9 D$PI) L$@I D$8H L$HH \$@H \$@H L$@H T$81 D$8H \$@H L$HH \$hH L$xL L$xH \$hH L$XL L$XH L$`f L$`H D$pH \$pM |$PM L$`L d$pL L$`L d$pA t$`L D$pH T$pH9 T$8H |$8H t$`L D$pH L$pH D$`H D$HH t$@H \$@H V(H9 t$pH) \$XD T$?H t$xL t$xH D$pL D$pI t$xH D$Ht^D T$>E t$xL T$?D T$>H t$xH D$HH t$xD D$pI D$pI \$>H t$xI T$pI \$XI D$`H t$PH T$hL T$`L9 T$@H T$hL T$@L9 t$xH ~eH9 D$pM |$ H t$(L D$0L |$ H t$(L D$0L \$Pf D$HH \$PH L$XH t$0L D$HH L$XH \$PH t$0L D$ H D$HH L$XH \$PH t$0L T$(@ |}H9 T$(I9 D$HH L$XH \$PH t$0L T$(@ D$ H D$HH L$XH \$PH t$0L T$(@ |$ H t$(L D$0L |$ H t$(L D$0L \$Pf D$HH L$XH \$PH t$0L T$(I9 D$HH L$XH \$PH t$0L T$(@ D$ H D$HH L$XH \$PH t$0L T$(@ |$ H t$(L D$0L |$ H t$(L D$0L D$hH L$xH \$pH L$xI t$PI |$(I T$0I9 D$hH L$xH \$pH |$(L T$0E D$ I D$hH L$xH |$(L |$0L9 D$ H D$HI T$@H T$@H t$pL L$HM D$hH L$xH \$pH |$(L D$hH |$(L |$0L l$@M l$HJ T$@H T$8H T$pH t$8L L$HN D$hH \$pH |$(L |$ H t$(L |$ H t$(L l$PL |$HH l$xN \$pN \$hN \$`H D$XH t$xL D$PL L$pL D$PH t$hL D$HL L$`L D$XL l$PI L$@H |$ H t$(L |$ H t$(L \$Pf D$HH t$hH T$0L L$xL L$XH \$PH D$0H D$hH L$0H t$XL D$xL9 T$PO D$(H L$ H T$HH D$ H L$XH9 D$PN D$(H9 t$0H T$HH D$0H |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L \$0I) L$8L D$8M |$ H t$(L D$0f |$ H t$(L D$hH L$xH \$pI) D$HI T$PI T$@H T$@H D$hH L$xH \$pH D$HL T$PH T$8L T$8I \$pH L$xH T$hH |dH9 |$ H t$(L |$ H t$(L D$PL D$xL L$`H L$`L D$PL D$xH T$ H T$(L T$8H t$ H D$PH L$`H \$XH t$ L D$xL D$PH L$`H \$XH t$ L D$xL T$(L t$8H T$ H T$0J T$0H t$XL L$8N |$ H t$(L D$0L |$ H t$(L D$0L D$@H t$`L D$hH L$PH \$HH T$ H L$(H D$@H L$PH \$HH t$`H |$ L D$hA D$hM |$ H t$(L |$ H t$(L D$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H L$ f L$ I "tEf \uRH 5l". D$XH L$PL \$hA D$pA D$XL L$PL d$HH D$XL L$PL d$HO |$hO D$pA l$hI d$`L \$@H D$XL L$PL \$@L d$`I hHH9 D$XL L$PL \$@L d$`I D$XL L$PL \$@L d$`I D$XL L$PL \$@L d$`I D$XL L$PL \$@L d$`I h0H9 D$XL L$PL \$@L d$`I D$XL L$PL \$@L d$`I D$hL l$PE1 D$xI L$@H L$@H T$xH t$HL L$HH 5es. M9,$ D$hD |$(D |$8D |$HH L$(H D$0H L$hH L$8H D$@H L$hH T$HL D$PH \$pH D$hH L$PH |$hH t$pA \$xH D$pH L$XH |$pH t$xA u-<,w H9 t$h1 |$xL D$pD D$pH L$hH9 40H9 t$hH T$xH D$pH L$hH9 t$hH D$XH \$8H D$@H L$8H D$ 1 :ujH D$hH D$HH \$(H L$PH |$01 L$0f D$8H \$@H D$ H L$pH T$hH T$hI t$@I T$ H D$81 L$@H \$ H L$(H T$HH T$HI t$@I T$ H \$@H L$ H L$@H T$8H T$8I t$ I D$X1 L$hH \$`H D$XH D$0H \$`H :*u"H T$XH T$0H |$ H L$0H \$ H T$8H L$0H \$ 1 D$8H \$ H L$0H D$8H T$0H D$8H D$8H T$0H \$ H t$h@ T$0H 8//@ \$(H D$@H T$(f L$ H) t$@H t$@H D$(1 T$ H L$8H T$0L \$ H D$01 D$8H L$8H \$HH L$8H D$pH \$HE \$8H L$hH \$ H D$PH D$hH \$0H D$`H L$ H T$PL T$PI D$`M T$0H D$XH L$(H T$XI \$pH L$H1 :u6H \$XH |$pI D$@H \$pH :u5L D$hL T$`I D$8H T$8H L$@H9 \$PH \$HH D$xH \$pH t$@H! L$PH |$xH t$HI D$hL T$`A D$@H \$pA D$pA \$XA D$(H D$(f T$(H9Z@t L$8H \$0H D$(1 ,w"@ D$(H L$8H D$(H L$8H \$0H T$(H L$8H9 L$(H L$8H T$(H L$0I D$(H T$(H9Zxt T$pH |$hH T$pH |$hI L$pH L$hL T$pH T$hH |$pH T$hH T$hH |$pI L$pL L$hL T$hH T$pH \$pL \$pfA D$pH \$XH D$pI \$XH L$pL L$hL T$hH T$pH T$pH \$PL T$pI \$PH L$pL L$hL T$hH T$pH \$`H \$`L \$pH \$pf \$`L D$pL D$pI \$`H L$pL T$hL T$hH T$pH |$HH T$pL T$pH |$HI L$pH L$hL T$pH T$hH T$pH \$@H D$xL T$pI D$xH \$@L D$pL L$hL T$pH T$hH v(UH \$8H L$XH T$`H D$pH \$HH |$XH \$HH L$`H D$pH L$xH D$`M \$HH D$xH D$`M \$@H D$hH L$pH D$@L =N{y D$hM L$`H 9/tuH D$HH |$xL |$xH \$GH t$FH 8..uHL t$FH |$pL t$FH uzfA 8..urL /u H t$FH |$pL L$hL L$hL t$FH |$pL vCUH \$(H D$ H D$HH \$PH D$0H D$0H t$PH L$PH T$HH T$HH D$0H =@qy =npy =3py D$(H \$ H D$(H D$0H D$HL |WfA 8//uOH tpH9 :u/H T$0H \$(I D$81 t$ L T$0L D$8H t$ L D$8L T$0H D$8A D$PH \$(A \$8H D$H1 \$8H D$HH T$0H t$(H L$@H D$@H \$(H L$01 \$8H D$01 |$0H D$(H L$8H \$0H T$(H L$8H9 L$(H L$8H T$(H =viy L$0I D$(H \$0H T$0H T$(H T$(H t$0H9F t L$XH D$`H L$XH L$PH D$hH L$hH \$`H L$hI \$`I t$PI L$hH T$`M D$8I \$HI |$@H D$HH \$8H L$@H D$`L D$HL T$@H D$`H \$hH T$@H =>fy D$HI D$`H \$hM v1UH l$ M9,$u v1UH l$ M9,$u vCUH l$0M9,$u H9S S0H9P0 H9P@ SPH9PP PY8SY H9Ph SxH9Px D$(H \$0H T$0H T$(H T$0H T$(H T$0H T$(H T$0H T$(H T$0H T$(H T$0H T$(H T$0H T$(H viUH P 8S u8H D$(H \$0H T$0H T$(H v{UH D$0H \$81 \$8H D$0H v1UH v~UH L$@H \$8H u6H \$0H L$8H vKUH l$8M9,$u D$@H |$XL t$`H |$XH \$HH D$@I T$HH t$@1 T$HH t$@1 L$ J T$ H t$HL D$@L T$HH L$`f L$XH t$HL D$@L T$HH L$ H |$(H t$0L D$8L L$@L T$HL L$ H |$(H t$0L D$8L L$@L T$HL \$Pf =E}y %4{y ?A3L UUUU UUUU |$PD |$`D |$pD |$ D |$0D v1UH \$hH |nH9 |$ H t$(L D$0L |$ H t$(L D$0L \$hH |nH9 |$ H t$(L D$0L |$ H t$(L D$0L L$HH D$8H D$ H D$ H \$8H |$HH D$ H \$8H |$HH \$ 1 \$HH D$@H \$Hf T$(H T$(H T$ H T$ H L$HH |$ H t$(L D$0L |$ H t$(L D$0L \$HH D$@H \$Hf T$(H T$(H T$ H T$ H L$HH |$ H t$(L D$0L |$ H t$(L D$0L vKUH l$8M9,$u vNUH L$`H L$`H D$hH t$PH T$HH D$HI) L$PL9 |$`H \$XH D$hH |$`I \$XH D$pL D$`H L$XJ D$XH L$`H D$PH L$HH \$hL RXL9 T$@H T$@I \$0H ;md5 D$(H \$0H D$(H vEUH D$XH L$hH |$pH \$`H t$(H9 D$XH L$hH \$`H t$(H |$pH @uWH D$XH L$hH \$`H t$(H |$pH) @|uH \$@H T$8H |$0H T$ H D$ H L$0H L$8H! \$@H D$XH L$hH |$8H D$XH L$hH |$8H |$8H D$(H |$ f =??y |$(D |$8D |$HD |$XH \$ H t$ H T$(H p $D QZ^&D Y[eD vxUH D$HH |$(H \$ H T$PH T$0H T$HH T$(H D$@H \$pH t\H9 D$@H \$pH D$xH \$HH D$8H D$8H \$hH D$xH \$XH \$XH L$PH L$PH \$`H D$0H D$0H \$`H |$ H |$ H L$pH \$hH D$@H \$HH \$hH t$pH T$pL D$`H \$hH \$8H D$0H9 u,H9 voUH D$8H vNUH L$`H L$`H t$PH T$HH D$hH D$HI) L$PL9 |$`H \$XH D$hH |$`I \$XH D$pL D$`H L$XJ D$XH L$`H D$PH L$HH \$hL R`L9 T$@H T$@I \$0H ;sha D$(H \$0H D$(H #EgH vLUH #EgH D$XH |$pH L$hH D$hH \$XH T$(L D$`I9 D$hH T$(H \$XL D$`H @u8H D$XH D$hH T$(H \$XL D$`H |$pH) t$`H |$pf @|^H |$8H L$0H t$@H T$ H T$ H t$8I L$0H! t$@H D$hH \$XH |$8H D$hH \$XH |$8H D$@H |$Hf D$0H |$$D |$,D |$x D$(H D$0H D$(H T$8H D$ H D$ H v0UH l$ M9,$u T$ H v%UH M9,$u D$pH L$@H L$@1 L$hH \$xH T$8H L$hH T$8H |$`H T$8H T$`H L$HH L$8H \$hH T$xH L$8H \$hH \$PH |$`H T$8H T$`H T$8H D$pH \$XH \$XH L$PH T$pH D$XI D$`H L$HH t$@H \$XH T$pH \$hH D$PH \$@H L$HH \$@H L$HH9 D$PL D$hM \$XH D$PH L$`H |$hH L$PH |$ D |$0H L$hH L$(H L$`H L$ H \$8H D$0H D$hH L$PH |$(D |$0D |$@H L$0H D$8H D$PH L$@H D$HH D$HH T$HH D$hH L$hH \$pL L$xH L$xH L$PH \$HH T$HH L$PH |$XD |$ht \$XH L$`H L$hH D$pH v]UH D$HH \$PH L$PH :"u*L L$P1 L$PH \u$L !t|A #tvA %tfA &t`A 'tZA *tTA +tNf -tFA /t@A =t:A ?t4A ^t.f _t&A `t A .udI T$`H T$xD T$xD L$EL D$F.. .t0H D$hH T$pH \$XH D$XH L$pH T$HH \$hH T$HH \$`H \$hH L$xH d$xA T$EL T$EL L$`L t7A 8v A !weH D$DL D$DL \$`L d$xD D$pI \$HH 5$}, D$pH \$HM =W'x D$@L d$hL D$@L d$hH D$pM D$@H D$pL =N&x t$hH L$`H D$PH t$XH L$x1 L$`H t$XL D$PL L$xA \$hA D$pH D$HL \$0H L$@H |$(H T$0H9 |$0H L$8H D$@H \$(H L$8H |$PH L$PH D$XH D$@H \$(H |$ H t$(L |$ H t$(L \$`H D$XH L$hH \$`H T$(H D$0H T$0H t$(H \$(H L$XH D$0H \$(H D$01 L$`H D$Xf L$8H D$@H L$8H D$@H \$8H D$PH L$`H |$HH t$/@ \$@1 |$hH D$`H L$hH D$pH |$hH L$hH D$pH D$XH L$0H \$@H9 L$0H D$XH t$PL l$XI |$XM T$pL d$hL |$8M |$`I T$pH d$hL l$8L |$`I D$PI |$`I d$hH T$pL l$8H D$Pu T$pH D$PL d$hL l$8L |$`I D$@H L$@H D$xL l$0H l$`f D$xL L$0L l$`I L$HH l$`I L$0L D$xH L$Hu \$/L L$HH \$/H D$xL L$0L l$`I D$0H \$8H L$@H |$HH t$PL D$XL L$`L T$hL D$0H \$8H L$@H |$HH t$PL D$XL L$`L T$hL rhH9pPuIH L$PH T$HH D$HH \$PH T$XH D$HH \$PH \$xD D$HH \$PH \$xD 52E5 t$@H t$@H T$hH T$XH D$p1 D$`H D$`L |$ H t$(L |$ H t$(L \$xf D$ H L$xL D$ H D$ H D$ H L$pL 5kR, T$HH t$ H t$ H T$HH D$xH D$8H L$PH D$8H T$PH T$81 t$ H |$0L @PL9GPt T$8H t$ H |$0A L$@H |$0L L$@I T$0H T$8H t$HH t$HH D$xH D$(H L$PH D$(H T$PH T$8H J(H9H(u T$8H |$PD |$8D |$ H |$hH |$pH t$hH L$xH \$pH L$8H L$ H L$0H L$HH D$`H D$`H D$`H D$`H |$8H L$ H T$(H L$0H L$8H D$@H |$8H D$HH \$PH t$@H L$XH |$ H t$(L |$ H t$(L \$xH L$PH |$XH :d~VH |$PH t$XL \$PH L$XH \$PH T$HH T$PH L$HI \$PH T$@H T$PH L$@f D$xL D$pH \$`H D$pI \$`L L$pL L$hM) T$pL T$hI \$xH D$pH L$HH D$XH t$8H |$PE1 D$@H t$8H |$PL D$@A D$XH \$0E -u M 8.t5H 9.t$H D$8H D$0H L$xH \$pH \$xH T$pH9 T$pH L$xH D$7H D$7H t$XH |$PH \$@H D$8H D$ H \$PH T$@H t$XH T$8H |$ E1 |$ H t$(L |$ H t$(L L$xH D$hH |$(H t$0D |$8D |$HH D$hH \$pH T$8H D$@H T$(H |$HH T$0H T$PH D$PI T$PH L$HH \$@H t$xH D$HH L$@H D$HH L$@H T$xH D$HH L$@H T$xH D$pH L$hH L$hH D$pH D$HH \$@H L$xH D$HH L$xH T$@L T$`H D$XI L$hI9L$Pt D$`I \$Hf L$GH B H9 5,n/ t$G@ t$GL t I9 z H9 5Pi+ B H9 t$GL N M9 B H9 D$hH B H9 B H9 t$GL 5|Q+ v{UH L$ H \$hL L$`H D$XI \$hH L$`M D$XH L$xH |$PH \$`H L$xH D$pH \$@H \$xH T$@H T$HH T$pI vvUH H9D$ \$ H v?UH H95art t-H9 |$8H H9\$Xu L$P1 D$8H vHUH L$(H D$0H L$hH \$`H |$(D |$8H L$(H D$0H L$`H L$8H L$hH L$@H 5Gru 5/ru T$XL l$hH D$`H |$hH L$`H T$XL d$PL =uLH \$pH L$ H |$(H t$0L D$8L L$@L T$HL L$ H |$(H t$0L D$8L L$@L T$HL D$HH \$P1 D$HH L$(H D$0H D$@H \$HH L$PH |$XH vhUH D$0H \$8H L$@H |$HH u0H9 vrUH D$(H \$0H L$8H |$@H D$(H \$0H L$8H |$@H O H9 v7UH vfUH D$(H \$0H L$(H T$0H9J vAUH |$8H \$H1 |$8H \$HH L$0H T$(H D$@H D$@H \$(H L$01 l$`M9,$ \$8H D$H1 \$8H D$HH L$@H T$0H t$(H D$@H \$(H L$01 M9,$ v5UH l$(M9,$u v`UH M9,$u H9D$ M9,$ v9UH l$0M9,$u v5UH l$(M9,$u v9UH l$0M9,$u vkUH l$HM9,$u M9,$u v`UH L$(H D$0H M9,$u M9,$u M9,$u v^UH D$(H \$0H T$0H T$(H D$(H D$0L \$XH |$hH L$`H D$(H O.sNu L$`H \$XH |$hH vsUH v1UH \$(H D$ H T$ H L$(1 \$(H t]L9 |$ H t$(L D$0L |$ H t$(L D$0L vKUH l$8M9,$u \$0H L$01 T$0H9 :cpu. L$(H T$(H9 |$XH L$ M L$hH ont! ofuRE fuFH T$PH 5'cu t$H1 D$hH L$`H D$pH D$xH D$pH D$xH D$@H D$8L T$PH t$HH |$XL D$@H9 T$PH =d_u v,UH vTUH D$0H \$81 D$0H \$8H *}TH t$0H |$8H |$XD |$hH D$XI T$PL t$PH t$LA |$|D |$ H t$(L D$0L |$ H t$(L D$0L ~bL9 |$HH L$PL L$8H \$`H t$XL T$@L L$PH \$`H t$XH |$HL L$8L T$@L9 T$pD t$hI \$PH T$PH t$hI \$hH D$PH L)@pL) |$ H t$(L D$0L |$ H t$(L D$0L T$LD T$HD \$DD d$@D l$fA o~ fA o~0fE oN@fA oNPfA oN`fA oNpfE oH0f o&fA -%]B e@fM uHfD o] f ou0fD MPM1 u0fD o&fA oe f o}0fD M`M1 }0fD M`fD o~0fA om fD oE0fD }0fD E0fD MpfD U`fD o~0fA o~pfA o] f ou0fD =mwA MPfD U`fD ]pfD ou@f }@fE o}@f ou@f }@fE o}@M m fD }0fD E0fD u0fD MPfD U`fD ]pfD o>fA o~ fA o~0fE oNpf B}Zp B}Z` }Z`0 }ou }oe@ }oM }om@ r$H }ou }oe@ }ou }oe@ }ou }oe@ oH0f MPfD U`fD ]pfD ou@f }@fE o}@f ou@f }@fE o}@f m fD }0fD E0fD u0fD U`fD ]pfD oN0f oNpf oN0fD o] f ou0fD MPfD U`fD ]pfD ou@f }@fE o}@L ou@f o}@M m fD }0fD E0fD u0fD MPfD U`fD ]pfD o>fA o~ fA o~0fE O0fD oNpf oN0fD oe f o}0fD }0fD o] f ou0fD }0fD MPfD o~0fA o] f ou0fD }0fD E0fD MPfD U`fD o~0fA o~pfA oH0f =+)A o&fA B}Zp B}Z` }Z`0 %^^A %R^A -oZA 5gZA =_ZA % ZA }ou }oe@ %@XA %4XA %xVA %lVA }ou }oe@ %)RA %?IA %4IA %"EA }ou }oe@ %7BA %QAA %FAA %]@A %R@A }ou }oM }oe@ }om@ %=?A %J>A %?>A }ou }oe@ %.8A %#8A }ou }oe@ %M5A -9/A 51/A =)/A v?UH D$ H L$ H T$(H9J( vUUH L$ H L$ H L$ I T$(I v,UH v!UH D$ H \$ H \$ H L$ I L$HH L$Hf HPKE E-v1H T$@H D$`H L$HH T$@H L$HH9 D$`H T$@H L$HH D$`H \$@H T$@H L$HH9 D$`H T$@H L$HH \$@H D$`H \$xH T$PH T$XH \$PH L$`H |$@H t$HL D$ H \$(H L$0H |$8H t$@L D$HL L$PL T$XL D$ H \$(H L$0H |$8H t$@L D$HL L$PL T$XL L$hH L$hH HPKE E-v1H S H9 L$hH T$`H T$`H L$hH9 T$`H \$`H L$hH T$`H T$`H \$`H T$pH T$xH D$@H D$(H \$0H L$8H |$@H t$HL D$PL L$XL T$`L D$(H \$0H L$8H |$@H t$HL D$PL L$XL T$`L T$hL D$hL |$ H t$(L D$0L |$ H t$(L D$0L |$;H |$@H D$;H |$nf t$lfA HPKE T$nf T$lf T$jf D$iH \$pH L$xH D$pL L$xL D$pL L$xL |$ f t$"fD D$$L L$(L T$0L t$"D D$$L L$(L T$0L D$FH L$`H L$xH L$DH T$Bf T$`H T$xH T$XH L$Df |$hH t$HL D$pH T$pI \$HH L$PH D$hH D$ L D$ L D$@H T$ H T$ H T$@H t$(H T$@H <;A1 D$0H D$0H |$ H |$(1 D$xH \$hH L$pH D$xH \$hH L$p1 |$ H t$(L D$0L |$ H t$(L D$0L L$@H |$HH \$8f D$0H \$8H L$@H |$Hf vYUH D$(H \$0H L$(H \$0H9S D$hH \$pH L$xH D$HH \$PH T$HH T$0L D$(H \$@H D$8H D$0H \$@H \$81 vTUH \$@H D$8H \$@1 vEUH D$HH v4UH D$(H \$0H \$0H D$HH \$PH L$XH |$`H \$0H D$(H |$ H L$XH T$0H t$ H D$(H \$0H |$`H9 L$XH \$0H |$`A D$(E D$PH \$XH |$hH t$pH \$8H T$8H D$(H D$0H \$8H t$pH |$hH L$(H D$0H t$pL D$0H t$pL L$(I \$ H |$ H |$ H D$hH \$pH L$xH \$PH D$HH) |$8L D$@M D$0H D$0I D$HH L$xH \$PH |$8L L$@M L$(H D$HH \$P1 |$(H L$(I D$HH L$xH \$PM t$hH L$HD T$/H t$pH |$xH D$/E D$8H T$8H D$xH D$`tND D$.E D$`H T$/H |$xD D$.H T$/H |$xD \$.H T$xI L$HI L$XH9 D$PH L$@H T$XL D$PL9 T$0H T$XL D$0L9 |$ H |$ H t$(f D$@H \$HH L$PH |$XH D$(H \$ H \$PH t$XH T$(H \$PH T$(H \$PH T$ H T$ H T$ H T$(H T$(H T$ H |$ H |$ H D$@H \$HH L$PH |$XH \$ H D$(H D$PH t$XH T$ H D$PH T$(H T$(H |$ H |$ H D$XH \$`H L$hH |$pH \$@H D$8H T$ H D$8H \$@L t$(H |$0H L$(H t$hH L$pI t$(H9 L$hH T$ H \$@H t$(H |$pA D$8E T$@H t$hH |$(L D$pI9 T$8H \$0H t$hH |$(L T$@H t$hH |$(H D$0H T$8H t$hH D$PH \$XH) L$`H |$ H \$8H T$(H D$`H \$8H t$ H |$0L D$(H \$@L d$8H D$xH \$pI \$hN L$`M L$XM D$xH \$pH L$hH |$@H t$`L D$0f D$xH \$pH L$XH |$8H t$PL \$pH |$HL \$@I D$xH L$0H D$@H \$HH L$PH |$XH t$`L D$hH D$(H t$hH D$PH D$XH L$PH L$ H T$(H L$hH T$(H T$hH |$ H t$(L |$ H t$(L vUUH D$8H \$@H \$ H \$ H9 L$HH |$PH \$@H D$8H L$ H T$HH D$@H t$8H |$ H \$@H |$PH T$ H9 T$ H L$HH T$ H \$@H |$PA D$8E |$hH t$pH \$XH T$PH D$XH \$(H D$PH \$XH t$pH |$hH L$0H T$ L D$0H D$PH \$XH t$pH D$PH \$XH t$pH T$ H T$0H D$(H L$8H |$ H |$ H L$hH \$`H D$XH) |$8H T$@I T$0H T$0H D$XH L$hH \$`H |$8L D$@H D$(H D$XH \$`1 |$(H D$(I D$XH L$hH \$`M t$hH L$HD T$/H t$pH |$xH D$8H T$8H D$xH D$`tMD D$.E D$`H T$/H |$xD D$.H T$/H |$xD \$.H T$xI L$HI L$XH9 D$PH L$@H T$XL D$PL9 T$0H T$XL D$0L9 |$ H |$ H L$HH |$PH D$8H \$@H L$HH t$PH T$ H9 t$8H D$@H L$HH T$ H T$8H D$@H L$HH T$ H |$8H D$@H T$ H T$8H D$@H |$8H D$@H T$ H T$ H9 t$8H D$@H T$ H T$8H D$@H T$ H T$8H D$@H |$ H |$ H L$HH |$PH D$8H \$@H \$HH t$PH |$8H D$@H T$ H \$HH T$ H9 t$8H D$@H T$ H \$HH T$8H D$@H T$ H \$HH |$ H |$ H L$`H |$hH \$XH D$PH L$(I D$PH \$XL T$0H L$8H T$0H t$`H T$hI T$0H9 L$`H T$0H \$XH t$(H |$hA D$PE T$PH D$XH t$`H |$0L D$hI9 t$PH L$8H D$XH t$`H |$0L T$PH D$XH \$ H t$`H |$0H D$8f D$ H T$PH L$8H t$`H D$PH \$XH) L$`H |$(H \$XH D$PH |$ H D$ M \$0L D$ L @(I9 D$PH T$(H \$XH |$8L L$`L t$0M |$ f \$HL d$@H \$pN L$hM L$`M L$pH |$HH t$hL L$`H |$@H t$XL |$PL \$0I L$8H L$PH |$XH t$`L D$hH \$HH D$@H T$hH D$PH D$XH L$PH L$ H T$@H \$`H T$hH D$(H T$@H L$ H T$hH D$(H |$ H t$(L |$ H t$(L vVUH D$8H \$@H L$ H L$ H D$8H \$@H9 L$`H \$XH T$8H T$8H D$PH L$`H \$XH t$8H9 |$`H \$XH L$(H L$0H D$PH \$XH t$0H L$8I T$(L D$8I D$PH \$XH t$0H |$`H9 T$pL L$hL T$pH D$(L9 T$0I L$`H P I) D$`L D$`I L$Xf ~?L9 D$(L L$XL T$pL9 }7M9 L$XL |$8H L$pH D$pH L$pH L$hH L$HH T$hH9 t$@H T$pH |$pH D$pH t$hH |$PH L$hH |$ H |$ H t$(f \$xH D$pH |$8H9 T$X1 T$PI) D$@1 T$H1 L$ H L$ H D$pH T$HH \$xH |$8H9 L$(H L$(H D$pH T$PH \$xH |$8L D$@L L$0H L$0H D$pH T$XH \$xH |$8L |$ H |$ H =F`v D$8f D$6# L$6H D$4' \$8H D$2< \$8H \$8H \$8H \$8H =W_v D$8I D$8f L$*H \$8H D$8I =mfv =ffv D$8f D$&/ L$&H D$$0 \$8H D$"+ \$8H D$ , \$8H \$8H \$8H =Y]v D$8I v$UH D$01 L$ H D$0f "}sH L$ H t$(H T$(I D$(f L$ H \$(H \$(H \$(H D$&< \$(H \$(H \$(H D$(I D$HH \$xH \$xH \$xH |$hH |$`L \$xH D$ H \$(H L$0H |$8H t$@L D$HL D$ H \$(H L$0H |$8H t$@L D$HL |$`H t$hH L$XH \$PH9 D$ H \$(H L$ H D$0H \$0H L$PH L$`H D$h1 L$0H \$(H L$PH T$`H D$h1 T$ H T$ H D$(1 |$ H |$ H w3f= tDf= t3f= w f= w:f= t*f= t2f= t'f= t!f= L$(H D$0H L$(H D$0H D$HH -uAH =u#H GZu H D$(H \$0H -u5H T$HH L$`H t$HH t$PD L$`1 D$pH D$pH D$pH D$pH D$pH D$pH D$xH L$X1 X0E1 T$hfD L$DH T$hL L$DI D$xH L$XfF ,bfE9 |$hH T$FL t$PH |$hD T$FI D$(H \$0H |$@H T$@H L$81 @fA9 PfA9 |$ H |$ H t$(f |$XD |$hH T$XL D$`H D$hH T$pH =u5H \$8H D$(H D$(H T$@H \$8H D$(H T$@H D$(H T$@H \$8H D$(H T$@H 5(Ev D$(H T$@H \$8H |$HL D$HH T$PH \$8H |$HH L$HH D$PH D$HH \$PH |$HH T$HL D$PH T$0H T$0H D$8H L$@H =^Dv D$ H =*Dv T$@H T$@I t$8I \$ H D$ H voUH D$HH \$PH D$@H D$`H \$hH D$XH =OBv T$XI D$PH D$PH v"UH |$ H t$(L D$0D |$ H t$(L D$0D vuUH D$8D L$hH |$PL D$`H L$PH |$XH L$PH |$XH |$ H t$(L D$0D L$8f |$ H t$(L D$0D vuUH D$8D L$hH |$PL D$`H L$PH |$XH L$PH |$XH |$ H t$(L D$0D L$8f |$ H t$(L D$0D veUH \$HH D$@H D$ H D$(H D$ H \$@H L$HH |$Pf \$ H L$ I v(UH D$0H \$xL \$ L \$(H D$8H \$@H L$HH |$PH t$XL D$`L D$8H \$@H L$HH |$PH t$XL D$`L \$xL \$ L \$(H D$8H \$@H L$HH |$PH t$XL D$`L D$8H \$@H L$HH |$PH t$XL D$`L \$xL \$ L \$(H D$8H \$@H L$HH |$PH t$XL D$`L D$8H \$@H L$HH |$PH t$XL D$`L \$xL \$ L \$(H D$8H \$@H L$HH |$PH t$XL D$`L D$8H \$@H L$HH |$PH t$XL D$`L D$@H D$(H L$(I |$ H t$(L |$ H t$(L D$@H |$XH D$@H D$(1 D$ H L$ I L$XH9 |$ H t$(L |$ H t$(L v"UH \$8H v"UH \$8H \$HH |$XH \$`H |$pH T$xH L$(H \$ H D$0H D$0H L$(H \$ H D$PH \$XH L$`H |$hH t$pL D$xL D$PH \$XH L$`H |$hH t$pL D$xL v1UH D$ H L$ f v5UH D$ H L$ f D$PH L$(H L$0H L$(H L$PH =:.v =!.v =w-v =^-v =E-v =x,v =^+v =R*v T$8H D$ H D$ H v0UH l$ M9,$u \$HH |$8H |$8H \$HH D$@H L$(H T$0H D$0H L$(H T$@f L$PH T$xH t$hH L$P1 L$`fD \$HH D$pL L$XH D$pH L$`H \$HH t$hH L$XD T$FA T$xE 59|* T$xH t$hH T$FI L$`fD D$pf T$HH |$8H T$HH |$8H t$0H L$@L D$(H \$xH L$(H T$0H 80u H \$xH D$pH D$PH D$XH 4Zf9 vaUH |$8H L$0H T$81 ,t L$@H T$0L L9H }aH T$`H L$@H T$0L \$8L T$0L D$HI D$`H L$@H \$8D d$.fE =1+t v4UH t$ H D$`H \$@H |$(H T$`H \$@H H9P }SH T$`H T$8L T$8H |$(I \$@H L$8L D$0L L$HI T$0H t$`H T$8H D$HI v4UH t$ H |$`D |$hD |$xH t$`fD T$hL d$xL \$pH D$XI D$XE L$,H T$HL l$@fD T$.L d$8L \$PL T$HL D$XD T$.L \$PL d$8L L9H }sH =P&t T$HD T$.L \$PL d$8L \$0L T$HL D$XD T$.L \$PL d$8L l$@I t$,fA D$PH \$8H |$0H T$PH \$8H H9P }OH T$PH =R$t T$(L 50z( T$(H |$0I \$8H L$0L D$(L L$8I T$(H t$PH T$0H D$8I v4UH t$ H D$`H \$@H |$(H T$`H =s"t \$@H H9P }SH T$`H T$8L T$8H |$(I \$@H L$8L D$0L L$HI T$0H t$`H T$8H =m!t D$HI v4UH t$ H D$`H D$HH T$@1 L$.H L$8L T$`H L$8H T$@L L9H }aH T$`H L$8H T$@L \$0L 56u( T$@L D$HI D$`H L$8H \$0D d$.fE v4UH t$ H v}UH D$XH t$(L L$0H t$@L D$8H t$(H D$XH T$ H D$`H \$@H |$(H T$`H \$@H H9P }SH T$`H T$8L 5`r( T$8H |$(I \$@H L$8L D$0L L$HI T$0H t$`H T$8H D$HI v4UH t$ H D$`H D$HH T$@1 L$.H L$8L T$`H L$8H T$@L L9H }aH T$`H L$8H T$@L \$0L T$@L D$HI D$`H L$8H \$0D d$.fE v4UH t$ H D$`H D$HH T$@1 L$.H L$8L T$`H L$8H T$@L L9H }aH T$`H L$8H T$@L \$0L 56m( T$@L D$HI D$`H L$8H \$0D d$.fE v4UH t$ H D$`H D$HH T$@1 L$.H L$8L T$`H L$8H T$@L L9H }aH T$`H L$8H T$@L \$0L T$@L D$HI D$`H L$8H \$0D d$.fE D$`H \$@H |$(H T$`H \$@H H9P }SH T$`H T$8L T$8H |$(I \$@H L$8L D$0L L$HI T$0H t$`H T$8H D$HI D$`H \$@H |$(H T$`H \$@H H9P }SH T$`H T$8L T$8H |$(I \$@H L$8L D$0L L$HI T$0H t$`H T$8H D$HI v4UH t$ H D$`H \$@H |$(H T$`H \$@H H9P }SH T$`H T$8L T$8H |$(I \$@H L$8L D$0L L$HI T$0H t$`H T$8H D$HI D$`H \$@H |$(H T$`H \$@H H9P }SH T$`H T$8L T$8H |$(I \$@H L$8L D$0L L$HI T$0H t$`H T$8H D$HI v4UH t$ H D$`H \$@H |$(H T$`H \$@H H9P }SH T$`H T$8L 5 `( T$8H |$(I \$@H L$8L D$0L L$HI T$0H t$`H T$8H D$HI v4UH t$ H D$`H T$8L T$`H L9@ }TH T$`H \$0L T$8I D$`H t$/A t$@H D$`H \$@H |$(H T$`H \$@H H9P }TH T$`H T$8L T$8H |$(I \$@H L$8L D$0L L$HI T$0H t$`H T$8H D$HI T$Jf T$Jf |$`D |$hD |$xH D$`H D$`H T$LH 58T( T$Lf T$FH *w~f +t|f ,uFH L$XH L$XH t$PH L$XH t$Pf D$HfD D$HH \$XH \$XH T$GH 5 ;( 5(g) 5H5( \$xI d$xE1 5T0( \$pH d$pE1 D$hH \$hH L$hL d$hE1 5[.( \$`I d$`E1 D$X1 \$XH d$XE1 D$PH \$PH L$PL d$PE1 \$HH d$HE1 D$@H \$@H L$@L d$@E1 D$8H \$8H L$8L d$8E1 5[&( \$0H d$0E1 D$(1 \$(H d$(E1 T$xH T$pH T$hH T$`H T$XH T$PH L$HH L$@H L$8H L$0H L$(H |$pH |$xH L$pH D$xH L$pH D$xH \$`L \$`D L$NfE L$pH D$xH L$pH D$xH \$`L \$`D L$LfE D$K#H L$pH D$xH L$pH D$xH \$`L \$`D L$JfE L$pH D$xH L$pH D$xH \$`L \$`D L$HfE L$pH D$xH L$pH D$xH \$`L t$FfA L$pH D$xH L$pH D$xH \$`L \$`D L$DfE L$pH D$xH L$pH D$xH \$`L \$`D L$BfE L$pH D$xH L$pH D$xH \$`L t$@fA L$pH D$xH L$pH D$xH \$`L t$>fA D$=+H L$pH D$xH L$pH D$xH \$`L t$s T$8L T$8H |$(I \$@H L$8L D$0L L$HI T$0H t$`H T$8H D$HI v4UH t$ H D$`H D$HH T$@1 L$.H L$8L T$`H =zL T$?H T$>H L$hH t$>@ t$>@ t$?H t$>@ t$?H \$hH L$pH D$HH D$XH L$XH L$HH \$PH t$>@ t$>@ t$?H t$>@ t$?H \$hH L$pH D$@H \$xH L$HH L$@H L$hH L$xH L$?H L$?H \$hH L$pH \$hH L$pH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L |$@H T$@L |$ H t$(L D$0L |$ H t$(L D$0L D$(H T$HH H9P }NH T$HH \$0L D$HH \$0D L$/E T$HH L9B }LH T$HH \$0L T$HI \$0D T$-fD T$HH L9B }NH T$HH \$0L T$HI t$+f D$@H D$(H L$(I L$XH9 |$ H t$(L |$ H t$(L vsUH D$(H \$0H T$(H t$0H9F t$`H |$XH \$HH L$PH \$HH t$`H |$XH9 L$PH \$HH t$`H |$XH D$ I t$`H |$XH D$ B L$PH |$HH L$PH D$(H9 |$Hf rHH) \$HH t$(H |$XH |$ H |$ H \$XD T$?H t$xL t$xH D$pL D$pI t$xH T$>E D$HH t$xL T$?D T$>H t$xH l$0A T$8H D$pI T$@H D$pI \$>H t$xI T$pI \$XI \$hf D$`H t$PH T$hL T$`L9 T$@H T$hL T$@L9 t$xH |$ H t$(L D$0L |$ H t$(L D$0L \$(H9 0q D$0L L$ H \$HH L$XH \$PH t$hL L$xL |$ H t$(L D$0L |$ H t$(L D$0L \$hH L$pH \$hH \$`H =|.q L$pH T$8L T$@L D$HL D$`H \$HH L$@H t$HL D$@L L$8H t$(f D$ H9 D$ H9 D$ H9 D$ H9 v1UH v,UH |$(f T$ H L$xH L$ H L$ H =$$q =!#q D$0H L$@H L$@H D$0H D$0H =K!q viUH D$(H D$(H T$pL D$(H t$hL T$0E L$81 T$xH T$pH t$hH t$H1 T$pL D$PH T$PH T$HH D$Pf D$PH D$PH t$`H \$ H B H)J(N T$HM9 D$xH L$HH |$pH L$0L H9Q0} D$PH L$@H \$ H t$`H9J( L$XH T$pH t$hL D$(L L$8L T$0H T$`H D$(H L$`H T$`H D$`H t$XH D$`H D$`H L$`H T$`H t$`H9N(sTH D$8H L$`H ~ H)N(H D$XL | H9 D$HH L$@L T$`H d$XL \$PL D$hH L$@H T$HL \$PL d$XL D$hH D$`H L$`H |$`H9G(sSH D$(H L$`H G H)G(L D$XH T$XH L$@H \$0H L$@H T$XH \$0H T$XH \$8H \$8H D$pL T$pH L$XH \$0H L$XH T$pH \$0H ~{H9 T$@L L$HH \$PL T$8H T$@H \$PL L$HL T$8I D$8H tRH9 L$ H L$ H T$8H r H D$PH \$XH vOH D$PI T$(H T$ H \$0H L$8H L$8H \$01 T$PH H H) \$ L \$ H \$ H |$(H |$0H D$(L L$0L T$8H T$@H L$HH \$ H L$(H t$0f |$(H |$0H D$(H L$@H L$HH D$(H t$0H v,UH |$0H |$8I \$@M L$(H L$(L T$0I D$ L T$(H D$ L L$ H L$ H |$ H t$(L |$ H t$(L \$PH D$0H \$HH L$0H \$0H 5wx3 D$ H t$(H \$0H t$(H D$ D \$0H M9,$u M9,$u M9,$u M9,$u l$ M9,$u M9,$u vKUH l$8M9,$u v@UH M9,$u D$PH D$@H D$ H D$0H L$0H T$ H L$0I T$ I \$PI L$@H \$ H L$@I \$ I t$0I D$HH D$8H D$(H L$(H L$(I \$HI L$8H L$8I t$(I vIUH D$(H L$ H D$(H T$0H vdUH D$0H vIUH D$(H L$ H D$(H T$0H vdUH D$0H v+UH \$@H v+UH \$@H L$@D t%H9 D$0H t$PH |$HH L$@H D$0H L$@H t$PH |$HH |$ H t$(D |$ H t$(D vIUH D$0H \$8H L$@H \$0H L$8H |$@H D$,H T$ H D$,H T$ H D$ H L$xH |$ H \$(H \$0H D$8H T$@H D$HH D$X8 D$`H |$pH 3D$d 3D$hH L$xH |$ H \$(H \$0H D$8H T$@H D$HH D$`H 3\$d 3D$hH L$xH |$XH L$PH \$HL L$PH D$(H9 T$ H |$XH) L$HK D$ H L$ 1 L$0L T$HD of0f ov0f T$pH T$pH t$`D D$hH |$xH D$xH \$hH T$xH |$hH L$hH |$xH L$xH \$pH D$`H \$pH L$xH D$p1 T$BH L$HH |$HH T$BE L$CH L$XH L$CE T$pH L$HH \$XH L$DH t$PL T$pH t$PD L$DI |$7H t$7@ t$7@ t$7f L$@H =FRm L$@H L$HH L$HH \$8H \$8H \$hH \$hI L$`H \$XH \$XH |$`H |$`H L$`L \$PH \$PH \$pH \$pI \$xH \$xI T$`H D$`H D$`H D$`H D$`H D$`H L$xH \$hH L$xH \$hH D$`H \$pH \$pH D$PH \$XH |$0H L$0H D$8H L$`H \$XH D$PH D$(H \$PH L$XH D$(1 |$ H \$xH L$ H t$ H \$8f D$0H |$HH L$@H \$8H T$0H \$8H L$@H D$xH t$CH t$CA D$xH L$PH |$HH D$`H L$PH |$HA D$`H D$DL L$XL D$DL L$XI T$xH \$hH D$`H L$pH |$xH \$`H \$`H D$`H T$`H T$`H T$`H L$0H L$HH L$8H D$@H \$0H L$HH T$`L L$pH \$hH \$hH L$pH T$`H T$0H L$0H T$0H D$XH L$hH \$`H D$XH D$XH \$`H D$0H \$@H L$hH L$hH D$8H T$hL T$hI D$8M T$hL T$hI D$8M \$@H T$@H D$PH \$XN D$`A D$pA |$XD |$`D |$pH \$XA D$`A D$pN L$0H T$HL L$8H D$PH L$0H T$HH |$XD |$hD |$xH D$XH t$`H t$hD |$pL L$xL T$@I D$XH \$`D |$ H t$(L |$ H t$(L v"UH D$ H L$hH L$`H T$hH L$`H T$hH t$@E1 D$HI t$@H D$HH |$HH9 L$XH r H T$8H D$xH L$`H D$PH L$XH |$0H \$pH T$0H t$pH t$pI T$PH \$xH L$XH L$hH L$XH L$PH v~UH D$XH \$`H L$hL d$@L d$8H T$0H D$@H \$8H L$0H |$XH t$`L vfUH D$(H \$0H \$08S vfUH D$ H 5Xzj D$ H 5xwj D$(H \$01 \$0H D$(H vjUH D$0H \$8f vHUH D$0H L$@H \$81 D$0H L$@H vNUH D$X1 L$(H L$(H |$8L D$@L L$0L |$8L D$@L L$0I T$@H T$8H \$0K T$0H t$XH T$8H D$@M D$hL \$pH L$xH D$pL T$`L T$HD T$MA t$`H u E1 D$hH T$`H \$pH L$xH D$hL L$ H |$(H t$0L D$8L L$ H |$(H t$0L D$8L D$hL \$pH L$xH D$pL T$`L T$HD T$MA t$`H D$Ff D$hH T$`H \$pH L$xH D$hL L$ H |$(H t$0L D$8L L$ H |$(H t$0L D$8L L$@N T$XL D$hH \$pH L$xH L$R@ |$S@ t$TD D$UfD L$VL L$PL L$HL L$PL L$PL L$0D L$5A L$IL \$XO T$`L T$`L d$XL L$HL L$@D L$BM L$@I s%N \$@H L$HH |$PH t$XL D$8L T$1H tQM9 T$@L D$8H T$0H L$ H |$(H t$0L D$8L L$ H |$(H t$0L D$8L L$'L L$'H s%H D$8H T$'L T$'H \$@H D$8H w-H) D$@H \$HH D$(D D$@H L$PH |$,D D$(D L$$H D$@H L$PH |$,f D$PH L$8H |$0E D$PH D$PH D$PH sKHc D$PH D$PH T$0H s7H t$8H D$PL \$(H D$pH D$,D D$,D L$-O D$4L D$$D D$)A D$6E8 L$PH \$HH T$@H D$httpu >http D$0H D$pf D$pH \$(H D$0H L$8H |$pH T$(H D$0H L$8H |$@D |$PH D$pH L$@H D$HH L$(H \$PH T$8H T$XH |$@H u H localhosH9 \$XH \$xH9 D$pH L$pH T$xH D$HH L$HH L$PH \$hL T$`H \$hL T$`L t$@L L$PM d$`I \$hL d$`L t$@L L$PM \$pH \$pH \$hH BHH9 \$hf L$xH |$XH 5x6: 8[u= ]u3H \$hH \$`H D$GH 8*.A L$`H L$xH L$XH =Q4: L$xH L$XH qHH9 =+3: D$pH L$XH D$xH \$`H T$XH T$`H t$PH T$`H t$xL D$pI t$xH T$`H t$xH L$hH |$HH |$xH t$`L T$hL \$xH L$`H D$hL vOUH D$01 v%UH D$XL |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$XH \$`H L$hH |$pH t$xH D$XH |$@H t$HL D$pH D$ H \$(H L$0H |$8H t$@L D$HL L$PL T$XL D$ H \$(H L$0H |$8H t$@L D$HL L$PL T$XL D$hL T$xH D$@H \$HH L$PH |$X@ t$`H T$(f T$xH L$pL D$hH D$hL L$pL T$xL T$HH t$@H T$xL L$XH D$PL D$ H \$(H L$0H |$8@ t$@L D$HL L$PL T$XL D$ H \$(H L$0H t$@L D$HL L$PL T$XL viUH P 8S u8H D$(H \$0H T$0H T$(H v&UH l$ M9,$u M9,$u v@UH D$XH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L l$0M9,$ D$HH D$0H \$8H L$@L L$PH D$HH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L l$hM9,$ \$XH |$hL D$xH D$0M t$pH |$hH T$ H9 L$`H \$XH L$`H \$XH t$pH T$ H t$pH L$0H D$(H |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L l$PM9,$ S(H9P(u^ P08S0uUH D$(H \$0H T$0H T$(H T$0H T$(H D$pH L$(H T$(H L$pI D$pH L$(H T$(H L$pI D$hH \$hH \$hH \$hH \$hH D$hI D$hH \$hH \$hH T$hI D$pH L$(H T$(H L$pI D$`H L$`f L$`I D$hH \$hH L$hI L$HH L$PH L$HH L$xH L$xH D$8H L$@H D$0H L$0I D$XH \$XH \$XH \$XH L$XI v$UH v$UH v$UH v$UH v$UH vjUH vvUH v$UH D$ H =!}o L$ H L$ I v)UH v$UH v$UH v$UH =v{o =:{o =Hzo = zo =Iyo = yo =Ixo L$!H \$(H =Kwo \$(H \$(H \$(H \$(H =Bvo \$(H \$(H \$(H =}uo D$" H \$(H =so D$$ H \$(H \$0H L$(I L$#H =lro \$0H =2ro L$(I L$"H \$0H L$(I L$!H =Uqo \$0H L$(I L$ H \$(H \$0H =Mpo L$(H L$(I T$0I =Zoo ="oo =rno =:no D$(f L$ H \$(H \$(H =tlo \$(H =,lo \$(H \$(H \$(H =]ko L$(I :httpu" :httpu L$xH \$XH D$`H D$`H D$xH |$HH L$@H t$`H D$XH \$81 T$xH D$PH T$xL D$P1 L$0H L$0H D$XH \$8H9 D$xH L$@H t$`H |$ H |$ H v9UH T$0H \$`L L$XL =Teo D$8H L$`H \$hH \$xH T$hH 9HEAD \$pH T$pH HTTPu" |$ H t$(L |$ H t$(L v,UH D$PH vbUH L$hH |$pH t$xH L$@H \$8H D$0H D$0H \$8H |$ H |$ H D$8H L$HH \$ H *http2.TH9 ransport t$HH T$@H D$PH t$8L D$@H \$HH D$8H \$PH L$@H |$HH L$hH D$pH L$pH L$pI D$`H L$`H T$hH L$`I T$hI =BVo D$@H \$HH D$XH \$XH \$XI |$`I =jTo D$@H \$HH D$8H \$PH L$@H |$HH L$xH L$@H L$HH D$xH |$ H t$(L |$ H t$(L L$@L d$HH |$PD |$`D |$pL \$pL L$`L T$PH D$PH \$41 T$HH T$HH vIUH D$(H L$ H D$(H T$0H vdUH D$0H =gPo v4UH L$ H D$ H vEUH D$8H D$0H |$8H t$0L D$8H D$8H D$8H \$@H L$FH t$F@ t$GH L$BH t$EL \$CH T$`H t$AH \$HH H9N0t T$hH L$`H =^Io t$hH |$C@ =kHo t$A@ I9I0t t$EH \$XH L$XH =xFo D$xH D$xH D$xH t$E@ t$EH t$EH \$CH =|Do ;GEu A ;HEADt D$PL D$PL T$CD! L$DH L$DL L$xH L$xH L$GH t$F@ t$GH \$xH L$xH T$GH t$F@ t$GH t$GH L$pH L$pH L$pH L$GH t$HH t$F@ t$GH \$`H D$XH |$8H t$@H T$0H D$XH T$0H \$`H t$@H |$8H T$8H D$ H D$(H =q;o L$(H T$ H L$(I T$ I t$`I L$XH v-UH D$XH D$XH D$`H D$PH \$@1 T$`H T$`H T$`I \$XI L$HH D$PH L$HH T$hH D$pH T$pH t$hI \$H1 \$xH T$PH 8Cook ietu 8Cookuzf ieur AuthorizH9 atiouJ Www-AuthH9 enticateH9p enticateH T$PH T$XH =V6o T$G T$GH \$FH L$pH D$hH \$hH L$pH \$`H T$`H =+d9 =d2o vKUH \$(H |$ f \$hH D$`H D$8H \$0H L$HH9 D$`H D$0H L$0H D$HH \$(H D$@1 \$HH L$(H L$@H D$8H D$8H \$0H L$HH vCUH D$(H L$(H v;UH D$(H \$ H L$(H |$PH L$HH \$@H D$8H9 D$8H \$@H D$@H T$PH9 D$8L D$ H \$HH L$@L D$xH =Z^9 D$8H L$xH \$HH =j*o \$hH T$PH T$PH L$GH \$XH L$hH T$XH T$HH T$HH \$pH \$x1 T$pf :pathf T$HH :domauNf inuFH =z&o T$HH :secu T$HH \$`H :expi =9%o ?s.H T$HH :max- T$HH httponlyL T$HH samesiteM9 8lauq 8noneuFH 8striu T$HH T$HH partitioL u9fA neu0A du)H T$HH 5Xw# =C!o T$HL 5Zv# =E o T$HL L$HH D$hH D$HH L$h1 |$hH t$PH D$HH \$@H L$XH t$PH T$hH L$HH \$@H \$@H L$HH9 D$`H |$xH |$xL \$pH \$pL ; Pa ath=L \$`H \$`L 5dn# ; DomainL |$CD |$PH ; ExpireL |$C1 5vj# 5qi# ; Max-AgL D$C1 ; Max-AgL ge=0L ; HttpOnL ; SecureL 5Je# ; SameSiL Site=LaxL ; SameSiL ite=NoneL ; PartitH titionedH L$hH L$hH v,UH D$PH T$`H T$`H L$xH t$xL D$`1 L$pH T$pH \$XH T$HH T$HH tSH9 \$XH |$hH T$pH |$hH T$pH \$PH L$GH L$XH T$PH \$pH |$hH |$hH T$pH D$PH D$PH D$ H T$ H D$PH \$XH .t'H L$hH \$8H D$@H |$@H t$8I D$@H \$8H T$PH T$PH L$PH |$pD T$pH L$xH L$pH t$HH L$HH T$`H D$hH \$XH D$GH \$XH L$`H9 5jU# t$G@ L$`H \$XH |$ H |$ H v,UH D$PH 8"u) vCUH D$ 1 mw9f wYf=k vXf= v,f= D$xH L$xI t$xL D$@1 t$xH T$`H t$81 D$xH D$@f D$XH D$XH T$XH D$0H T$`H t$8f D$0H D$P1 D$H1 |$ @ D$PH t$pH |$hH L$`H \$XH D$8H T$PH t$8L T$PI t$8I D$`M D$(H t$XH T$PH L$hH L$(I T$0H L$ H L$(H T$0H L$(I T$0I \$hI L$ H L$pH D$(H |$ H |$ H v0UH l$8M9,$u \$xH D$pH T$pH T$pH T$pH t$@H T$HH D$H1 T$pH T$@H T$@H D$HH T$@f T$@H D$XH T$XH L$HI T$@H D$PH T$PH |$ H |$ H t$(f D$hH L$xH \$pH T$8I L$xH \$pL L$hI T$PH t$01 D$(H T$PH t$0H9 D$(H T$hH L$pH \$'H L$hH L$hH D$HH T$hH T$hI t$HI D$@H L$pH L$@I L$@H \$pH L$@I \$pI L$xH \$'H T$@H T$@H L$@H |$ H t$(L |$ H t$(L v4UH l$@M9,$u D$`H t$HH |$PI L$XH \$@H L$XH \$@H t$HH |$PL D$`H D$`1 T$HH T$HH D$`H T$HH D$pH T$pH L$`I T$HH D$hH 5G@# T$hH |$ H t$(L |$ H t$(L t$pH t$pH |$`H L$HH T$xL \$hL D$xH L$HH D$XH t$PH T$PH T$XH v/UH l$ M9,$u |$8H L$@H T$0H L$ 1 D$(H D$(H L$ H T$0H9 v/UH l$ M9,$u L$H1 D$0L D$0H =oPk T$0H L$0H |$PD |$`D |$pD L$dH L$hH L$pH D$@H D$HH D$HH |$PD |$`D |$pD L$\H L$hH L$pH ~hH= D$Hf |$(H L$(H D$0H L$XH \$hH |$PH T$(L D$0H L$XH T$(H \$hH |$PL D$0L) L)@(H L$HH t$XH |$`L D$@I |$8H L$PH D$8f |$PH L$HH t$XH |$`L \$PH D$HH L$XH Z(H)Z0L D$(I) T$XH |$(H \$0H L$ H P0H9 T$HH r H9 rfH) t$ H9 T$HH t$ H D$hH H9x } T$hH L$HH \$@H D$PL T$hH L$HI D$PH \$@H vyUH D$HH L$(H D$0H vHUH L$(H D$0H \$,H L$0D |$XD |$hD L$XH L$hH D$pH L$0H L$xH |$8D L$8H L$HH D$PH v}UH \$pH L$(H \$0D |$8D L$8H D$@H D$0H L$HH D$PH vMUH D$HD L$(H D$0H vMUH D$HD L$(H D$0H vMUH D$HD L$(H D$0H vMUH D$HD L$(H D$0H v}UH D$HH T$HL D$(L T$0H t$(H T$ H t$8H t$8L T$?H T$;L T$PH D$xH D$xH L$HH D$PH \$xH t$HA L$HH D$PH \$xH t$HA T$jH D$H T$HH D$PH \$xH t$HA D$PH |$hH t$pH \$XH D$PH L$XH |$8D L$6E1 |$ H |$ H t$(f D$XH T$@L T$@I D$XH D$XH T$XH9 D$`H L$`H D$HH L$HI D$0H T$0I t$`L T$`H D$`M D$@H \$(H L$`I D$8H D$@H T$8H D$`M vvUH T$ H T$ H t$TH T$LH D$@H D$xH \$XH L$`H T$;H t$@D D$DL \$xL \$XL \$`L L$pH L$HH L$pH D$hH D$hH \$pH T$hH D$hH =[/k T$pH t$HH L$@H t$0H |$) f 9T$0 \$`H L$`H L$pH t$n D$@L L$hI D$@L T$@H @hH9 T$`H D$@L T$hI D$@L T$@H @hH9 T$`H =U;n L$HI D$XH T$XI D$PH L$PI T$XI D$PH ==:n L$PI L$0H |$HH L$HH |$PH T$XH T$HH T$`1 |$8H L$8H |$@H T$XH T$8H T$`H =E8n T$0L v%UH M9,$u v%UH D$@H v%UH D$@H v5UH L$PH |$XH T$(M T$(H T$(H |$0H \$0L L$8H T$HH t$PH D$@D D$xL |$01 T$(H |$ H t$(D |$ H t$(D =I2n p(t1H = +n =`-n 9P4v =j+n =}*n =c(n |$ H |$ H vvUH T$ H T$ H v%UH l$ M9,$u L$hH \$`H D$XH D$0H L$@H \$8H L$XH D$0H D$0H \$8H T$hH \$8H D$0H L$@H \$hH |$xH L$pD |$0D L$0H D$8H D$pH L$@H D$`H T$`H T$pH L$hH t$xI T$`H T$`L \$8H T$0f \$hH |$xH |$ D |$0D |$@H T$ H L$0H \$(H t$@L D$HH |$81 |$ D |$0D |$@H T$ H L$0H \$(H t$@L D$HH |$8H |$ H t$(L |$ H t$(L v,UH D$PH v,UH D$PH \$HH L$PH |$XL D$hH D$@L L$pL D$hH t$`H |$XL T$xH \$HH L$Pf L$PH \$HH t$`H |$XL D$hL L$pL L$PH \$HH t$`H |$XL D$hL L$pL L$PH \$HH t$`H |$XL D$hL L$pL t$`H |$XL D$hL L$pL |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L T$@f D$HH L$XH L$ H9 D$HH L$XH L$XH \$PH T$HH L$PH L$HH L$HH D$PH L$HH |$XH D$0H \$(H \$(H L$0I T$HH |$XH D$HH L$HI D$PH L$@H L$PH |$xD t$xH D$xH \$81 |$XD |$hL L$HL L$hH T$XH D$XH \$01 L$@H D$xH |$`H L$XH t$PH D$xH L$XH t$PH |$`L L$ H L$XH L$(H L$`H L$0H L$PH L$8H D$@H \$HH L$xH |$ H t$(L |$ H t$(L L$ H9 |$(H T$0H vkUH D$(H D$(H |$@H T$XH \$0H L$8H L$0H \$(H D$ H T$@H D$ H v/UH l$ M9,$u L$`H T$`H D$XH t$XH T$hH \$xH D$pH t$XH \$xH D$pH T$hH \$D1 \$pH L$xH D$hH D$XH T$xH \$pH D$XH T$xH \$pH D$XH T$xH \$pH D$XH T$xH \$pH D$XH D$XH T$xH \$pH D$XH T$xH \$pA T$CI D$XH T$xH \$pH T$CE D$XH T$xH \$pH v%UH M9,$u v%UH M9,$u v%UH M9,$u v%UH M9,$u v%UH M9,$u v%UH M9,$u v%UH M9,$u v%UH M9,$u v%UH M9,$u D$pH D$HH \$@H L$XH T$pH D$8H \$0H L$PH D$HH \$@H L$Xf D$HH \$@H L$XH |$8H t$0L T$pL T$pH T$pH \$`H L$hL |$@D |$PH T$@H T$`H T$HL L$PH D$@H \$01 D$XH T$XI |$xD L$XH L$xH D$xH \$81 \$`H L$@H |$hH D$hH L$@H \$`H L$HH D$HH \$PH D$HH D$HH \$PH |$H1 D$HH \$PH v%UH M9,$u t$0H T$@H D$HH T$0H |$pH \$pH L$xH D$@H |$`H T$`H D$hH D$pH \$xH D$PH \$XH D$@H \$pH L$xH D$@H \$pf \$8H \$8H \$XH \$PD \$PH t$XH |$`D |$pD T$XL T$pL L$`H D$`H \$41 t$HH T$@H D$@H \$HH |$ H t$(D |$ H t$(D \$@H L$8H9 \$@H \$hH L$pH |$xH |$HD |$XH T$HH T$hH T$PL L$XH D$HH \$01 |$ H |$ H \$hH L$pH |$xH D$`H t$HH |$@H L$8H L$(H9 D$`H L$8H \$0H t$HH |$@H \$0H \$01 L$8H t$HH D$`H L$8H \$0H t$HH |$@H |$ H |$ H t$(f L$@H9 L$PH H+Q( T$pL T$hH T$HH T$`H T$XH T$hH \$`H t$XH T$hI \$`I t$XI |$pI L$HH L$pH L$HH L$`H L$XH T$pH \$`H t$Xf T$pI \$`I t$XI L$HH |$xD T$xL T$xH |$ H |$ H v3UH l$@M9,$u v4UH l$@M9,$u L$(H9 T$8L D$@H \$HL L$PH L$$H T$ I T$0I T$`H L$lH L$0H L$pH L$`H L$xH \$XH |$ H t$(L D$0L |$ H t$(L D$0L T$@H D$8H D$8H v%UH \$0H D$0H T$0I \$8H T$0H L$LH |$PH L$(H9 L$@H L$HH L$@H9 T$PH T$PH \$hf T$PH T$PH =fKj D$PH L$`H \$HH L$`H D$XH \$hH |$pD T$XH T$XH D$pH \$xt T$hH |$ H t$(L |$ H t$(L L$`H9 t$PH L$HH t$DH L$GEu" ?HEADu ?GEu" >HEADu L$ H T$(H disjointH92u D$(H C0H9 D$pH \$xL L$8I T$(I |$PK L$0H d$HO d$ I D$pH L$8H L$0H t$PH T$ L T$(L D$HD |$@L \$XL |$@L \$XA L$0H T$ H t$PH |$@L D$HL L$8L T$(L \$XA disjoint disjoint D$HH disjointH9 overlapsH90 equivaleH9 moreGene moreSpec ific moreGeneH equivaleH91u u!H9 rau> moreSpecH9 ificu |$`H L$XH L$XH |$`H L$(H D$0H >GEu" ?HEADu ?GEu" >HEADu L$PH D$XH \$0H D$PH equivale ntuaH overlapsH9 D$0I D$pH \$HH D$hH \$@H D$`H \$8H D$pH D$hH D$`H L$XH \$(H moreGeneH D$PH9 moreSpec ific moreSpec moreSpec moreSpec moreSpec D$PH moreGeneI moreSpecH ific uwI9 urfA rauiA |$xD L$xH D$XH \$0f L$XH \$hH |$PL D$`H L$GL D$GE D$GE L$XH |$PL D$`I \$hL L$HL |$PL D$`L L$HI T$PL T$HL \$`K T$HH T$PH T$`I L$XH \$HL T$xL D$XL L$`H d$PH |$pH |$GH 5p1 |$pL D$XL L$`L T$xL \$HL d$PI l$hH |$pL l$hH L$pL |$hH T$hH T$pH D$XL L$`L T$xL \$HL |$pH l$GH |$pL D$XL L$`L T$xL \$HL d$PI l$hH |$pL l$hH |$pH L$hJ T$pH T$hH D$XL L$`L T$xL \$HL d$pL \$hL D$xH D$xL \$hL d$pL D$xL \$hL d$pL D$xL d$pH \$hH \$hL D$xL D$xL \$hL d$pD l$GL 5!' D$xL d$pH \$hH 5A& \$hL D$xL 5%% D$HH 5V$ \$hL D$xL D$xL d$pH \$hH 5A" \$hL D$xL D$GE 5F \$hL D$xL d$pI vOUH \$0H u$H9 \$8H L$@H \$8H D$0H T$@I t$0H L$8H L$@H D$XH \$8H \$PD D$XH D$hH \$HH T$xH =`>+ D$hL L$HH \$@H \$PH T$@H T$`I D$pH \$xH L$pI \$PH L$HH T$hI D$pH \$xH L$pI \$hH L$`H L$0H \$ H D$8H L$0H multipar t/miuxf xeup T$`H \$HH L$@H |$(H L$@H \$HH |$(H v%UH \$HH L$P1 L$OH \$hH =(8+ L$hI >CONNuFf ECu9 Tu.H |$hH |$`H |$`H L$PH D$PH D$PH L$hH \$PH \$PH \$PH D$PH L$PH L$PH \$PH rxH9 \$XH D$PH L$XH |$`H |$ H t$(L |$ H t$(L v{UH v&UH vOUH D$01 \$HH D$@H D$(H T$HH9 D$(L) \$@J D$@H \$HH D$@H \$HH D$8H HTTP/1.0H9 HTTP/1.1H9 \$@H D$8H T$@H .unH D$ H D$8H D$ H |$8H D$`H L$0H L$`H |$`I T$8H T$0H 5-.6 T$hH T$XH T$PH T$HH L$HH L$PH L$XH 5m,6 \$XH L$HH L$@H L$@H T$XH) \$HH) T$(H T$(H |$8L |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L L$(H L$ H L$0H L$(H L$ H L$0I 5y(6 D$XH L$HH D$PH L$8H D$@H D$@H L$0H D$8H L$ H D$(H L$ H L$ H L$0I D$(H L$HH D$PH L$8H D$@H t$'H D$0H D$0H \$(H D$(H L$(I L$(I vEUH v[UH L$0H \$ H D$(H D$(H \$ H L$0H vjUH vKUH M9,$u \$HH @(I9 D$@H T$@H r(H9 t$ H L$@H D$ H D$(H T$@H t$ H |$0H t$hH !umH \$(H D$PH D$PH \$(H t$hH |$0H |$0H t$h1 t$hH |$01 L$@H |$`H L$`H L$@I D$ H T$0H T$hH T$ H9 D$HH D$XH \$HH T$0H T$hH t$8H t$8H >POSTt'H >PUu >PATCuK L$xH L$xH \$@H \$XH t$0H T$hH |$0H T$PH T$PH |$0H L$PH \$HH T$HL T$PI \$XH D$pH \$pH L$XH L$xH \$@H L$xH \$@H t$(H T$`H |$(H T$PH T$PH |$(H L$PH \$HH T$HL T$PI L$xH L$0H T$`1 D$PH D$PH L$hH |$8H t$(H T$XH D$xH |$(H T$HH T$HH |$(H L$HH \$@H t$pH) T$@L D$xI T$HI T$pI L$hH D$xH |$(H T$HH T$HH |$(H \$HH t$pH L$@I T$HL D$xI T$@I L$pI L$PH L$PI D$0H \$`H \$8H D$0H \$8H D$0H L$@H \$8H vXUH vsUH viUH D$0H T$0H D$`H |$@H t$xH L$@H \$xH |$@H t$x1 \$(H T$`H T$`H \$HH L$`H T$`H tQH9 L$pH \$8H \$8H L$p1 T$`H \$hH no-cacheH92 \$hH \$hH \$`H D$`1 L$XH L$0D D$XH D$PH T$XH L$XH9 \$`H L$XH \$XH D$hH \$pH =d|k 9chunu D$xH :chunu cvIH D$xH D$@H \$@H T$(H t$ H t$ H T$(H L$ H \$0H |$PH L$(H L$(H |$PH \$0H D$8H L$(H |$PL D$8H |$@H D$@H T$HH D$81 T$hH D$8H T$hH L$pH :/uxH t$01 t$h1 T$HL l$ L T$PL \$@I T$`H T$PH t$`H D$@I9 t$HH T$ L |$xH L$pL T$PH t$hH t$pL t$hH T$HL l$ L |$xH D$hI l$ L |$xH t$hH l$ L |$xH D$hI D$XH \$XH L$(1 |$hH L$(H D$hH D$hH t$0H9 D$hH v_UH \$PH L$XH |$`H T$PH t$PH D$XL \$PL D$pL L$xH t$hL D$pL D$HH =znk L$hH L$hI T$xI L$pH |$`H L$XH |$`H L$XH t$PH t$hL D$pL |$`H L$XH t$PH t$hL D$pL |$ H t$(L D$0L |$ H t$(L D$0L \$xH \$xH L$pH D$HH L$pH T$pH 5zm% T$pH D$HH =]kk T$xI L$xH L$HI t$XH D$@I T$pM D$@H t$XH =zjk T$PI =Ojk t$@H T$XL D$PH D$pH T$XH \$xH \$XH |$hL D$xH D$PL D$xH t$pH |$hL L$`H \$XH \$hH L$pH |$xH D$PH t$pH |$hL D$xL T$(H T$8L d$0H D$PH L$`H T$8H \$XH t$pH |$hL D$xL |$ H t$(L D$0L |$ H t$(L D$0L \$`H D$XH t$xH |$pH L$hH \$`f T$hH :HEADu;H T$XH T$XH \$pH L$x1 \$pH L$x1 T$0L L$@L \$8I T$XL L$@L t$xH L$0H T$@L \$8H D$XH L$hH T$@H \$`H t$xH |$pL |$ H |$ H t$(f \$@H D$XH L$`H |$HH T$@H L$XA T$@L L$XH =^ck \$`H D$hH L$PH T$PH9 \$PH \$PL D$hH L$`H |$HI T$PL L$xL d$pI D$XH L$`H \$@H |$HL L$xL |$ H t$(L |$ H t$(L D$HH \$PH L$ H T$ H L$(H D$0H |$PH L$(H) T$0H \$PH |$`L D$pH D$HH t$hH |$`H L$XH \$PH \$pH \$pH \$`H L$hH D$HH t$hH |$`L L$ H T$0L \$(H D$HH L$XH T$0H \$PH t$hH |$`L D$pL |$ H t$(L |$ H t$(L |$`H T$`H L$hI L$HH L$HH |$0f T$XH L$@I L$@H T$XH L$PH L$PH v>UH |$PH D$hH L$xH L$@H L$hH L$HH T$@H |$xH T$hH T$hH L$pH L$xL D$pM /uEH T$hH T$hH =0Zk D$pA 8/t H T$PH |$pH |$ H |$ H v%UH M9,$u L$hL t$xH |$`L9 t$xH |$`L L$hH T$@H t$xH |$`L L$hL T$@H =lWk D$pH T$XL \$PH T$HH D$@H T$HH t$`H D$pH t$hH t$xH t$xI L$PH |$ H t$(L D$0L |$ H t$(L D$0L :CONN \$@H D$pH L$@H T$pI \$PH \$HH L$PH L$Hf I9H@u L$HH |$XH T$HH \$0H D$`H T$0H T$`I |$XH \$8H D$hH L$8H =kRk T$hI T$xH \$PH T$Pf t$xH L$pH L$hH L$pH t$xH L$hL L$xL L$`L \$XH L$`H L$xL T$PL \$XL |$ H |$ H v0UH l$ M9,$u D$pH D$pH D$pH D$pH D$0H T$/D T$/H \$pH D$xH T$pH L$xI =}Jk |$ H t$(L |$ H t$(L L$ H L$ H T$(H v/UH l$ M9,$u D$pH D$pH \$xH :HEADu |$PH L$PH D$XH L$pH t$PA D$pH \$xH D$@H D$@H T$pH \$8H L$HH D$@H L$HH \$8H L$HH \$8H L$pH \$8H L$HH v9UH D$01 D$0H D$(H T$@H L$(1 D$(H v$UH |$HH |$ f v$UH |$HH |$ f Trailer:L9 Trailer:E1 L$@L D$xH t$HH L$`H L$`H T$@H T$HH =aCk L$xI D$pI D$pH |$XH |$XH t$hH t$hH D$PL \$hH D$HH T$`H T$`H T$@H ={@k T$HI D$8H \$ H D$0H \$(H L$8H ={?k L$0I vfUH L$xH L$xH T$HH D$`H |$`H t$pA D$@H \$PH D$@H \$PH L$XH :HEADteH T$hH D$HH D$@H \$PH D$@H \$PH L$XH t$pA \$PH L$XH D$@H \$PH L$XH t$pA D$@H \$PH D$@H \$PH L$XH T$HH \$pH D$@H \$PH L$XH vMUH M9,$u D$ H L$ H L$ H v'UH |$8H L$(H L$PH L$0H T$(H L$PI T$8H T$8H v%UH M9,$u v4UH l$ M9,$u D$HH D$ H \$(H L$0H T$ H D$HH \$(H D$Hf D$HH L$(H |$8H L$(H L$PH L$0H T$(H T$8H T$8H v4UH l$ M9,$u vWUH D$ H D$ H D$PH |$hH L$`H t$`H T$(H D$PH T$(H \$XH \$ H D$(H L$8H \$ H D$PH \$ H L$(H)H( D$PH D$(H \$ H L$8H vFUH D$(H D$XH T$0H L$hH \$`H t$8I L$hH T$0H \$`H t$8H |$pL D$XD T$0H L$hH \$`H t$8H |$pL L$hH \$`H |$pL L$@H D$(H \$ H D$(H L$@H D$(H L$@H \$ H v$UH ?s-H D$HH \$`H L$pH D$hH \$XH L$PH L$`O D$xK \$pM l$HI D$hI T$XH D$XI T$PH D$PI l$hH T$XL D$xM -3j+ D$CfD \$Bf T$DH T$DH l$FL D$CH \$BL GMTL |$ H t$(L |$ H t$(L \$hH D$`H \$hH t$PH |$HL t$PH |$HL L$pH \$@H D$8L 9POSTu t$XH D$xH L$6H uafA 8PRuYA IuRL 9*u#H HTTP/2.0M9 8CONNu L$7H D$xH L$3I L$7H D$xH t$6@ t$7H D$xH t$6@ t$7H D$xH L9R@u L D$HH \$PH |$8H t$@L \$8H L$@H D$5H D$4H t$6@ t$7H D$xH L$7H D$xH =( b L$7H D$xH L$7H D$xH L$XH D$xH vNUH D$ H T$(H \$`H |$xH L$(H L$(H T$8H D$8H D$pH T$`H D$hH |$xH \$`H D$8H D$0H L$PH D$0H L$PH D$0H L$PL L$XH T$HI \$0H9 D$@H \$hH L$XH T$@H L$0H9 \$PI L$0H9 wzH) \$hL D$0H D$hH L$hH L$pH |$xH D$gH D$pH t$xf D$pH t$xf t$XH L$`H L$`H T$pH D$pH D$pH D$hH D$hH D$hH \$hH9 D$xH T$xH L$hH9 L$hH9 w~H) D$hH |$8D |$HD |$XH t$@H T$8H t$PH T$HH t$`H T$XH T$81 L$(H T$hH t$ H T$0H \$0H L$(H 8HEADA t$hD D$kL L$iH L$iH Trailer:H92A Trailer:E1 L$oH D$iH D$pH T$iE D$pL T$kE D$pL T$kA t$h@ keep-aliH92u t$hH D$pL t$hM :closu M9H@u T$hL D$jL D$jH D$nL cv H T$pH T$pH \$pH identityH \$pI identityH identityH \$pI identityH ;HEADu 8chun L$hE T$hH |$xH T$hH L$pH \$0H D$@H D$@H \$0H T$pH D$@H \$8H D$HH T$pH D$HH D$xH D$@H \$8H D$xH \$@H D$xH |$HD |$XH L$HH D$PH L$XH D$`H \$xH t$HA |$ H t$(L |$ H t$(L v*UH \$PH v(UH \$P1 D$`H |$hH \$XD \$xH |$ H t$(L D$0L L$8f |$ H t$(L D$0L D$ H L$ H D$ H L$ H L$ H L$ H L$ H :HEADtBH cv$H H9Pht H9Q@u v+UH L$0H D$0H |$H@ t$PH \$8H L$@H D$0H L$@H t$PH D$0H L$@H t$PH |$HH L$HH |$0H t$P@ D$8H |$ @ vHUH \$`H \$@H =q[* D$@L L$8H \$0H D$(H \$0H L$(H \$0H 9readu L$(H H9~(tCH H9Q@u %log 5;\5 GET u HEADu? OPTIu POSTu PUT u http/1.0 http/1.1H92 D$0H \$@H 5.9g D$8D |$PD |$`D |$pH L$HH L$PH D$XH L$0H L$`H L$@H L$hH L$pH D$xH L$HH D$HH |$ H t$(H D$XL L$`H D$0H \$8H L$@H |$HH t$PI T$hL D$XL L$`H L$@H D$HH |$hH D$XL L$`I D$PL |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L |$ H T$XH ~0H+~(H ~0H+~(H |$0D |$8D |$HH T$0H T$8H D$@L L$HL D$PL |$hL D$xH D$`H L$`I D$(H L$(I T$XH \$(H D$8H \$ H D$0H \$(H L$8H L$0I D$HH |$(t D$(H \$0H D$HH \$PH \$PH D$HH D$HH \$PH |$(t D$(H \$0H v)UH \$0H L$8H L$xH \$pH D$hH D$@H \$(H D$8H \$0H L$@H L$8I D$@H \$(H D$8H \$0H L$@H L$8I L$hH D$pH L$hH L$@D |$HH D$xH L$HH D$PH D$@H \$pH |$ H |$ H v.UH D$8H \$@H D$pH \$_H \$hH L$hH ?GEu ?HEAD \$`H t$`L 5PRg L$^H \$xH |$ H t$(L |$ H t$(L v4UH \$HH L$PH D$Xf D$8H L$(H T$8D /uwf 8/tfL uDH9 \$0H D$@H L$(H T$8H D$@@ veUH \$8H D$0H D$0H D$0H \$8H D$0H \$8H \$pH ?CONN L$hI \$PH L$PH L$pE1 T$pH t$hL \$hH \$XH L$hI T$XH T$XH t$hL \$xH L$xH T$Xf L$`H \$@H L$@H |$`1 \$HH L$HH L$XH L$0H L$8H D$PH D$XH \$0H L$8H =O(* \$(H D$hH \$@H L$(H T$HI D$`H \$PH L$hH L$`I |$hH D$XH \$`H L$hH |$pH \$@H D$XH D$HH t$PH D$HH \$`H L$hH |$pH \$@H D$x1 L$@H L$xH |$`H t$PH D$HH \$`H L$hH |$pH D$HH \$`H L$hH |$pH t$PH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L v0UH l$ M9,$u \$@H D$ H T$ H9 |$pH D$pH D$pH D$PH D$PH L$XH L$`H L$hH D$8H \$@H D$8H \$@H L$HH D$8H \$@H L$HH |$ H |$ H t$(f v{UH v0UH l$ M9,$u L$`H \$XH D$0H \$ H D$(H \$8H L$0H L$(I L$`H \$XH T$hH \$XH L$`H |$ f |$hH L$hH D$pH L$hH \$XD L$XH D$hH \$pH L$xH |$HD L$xH \$xH \$xH T$xH T$xH D$`1 @hH9 5i % T$xI D$hH D$hH \$pH L$hH D$pH L$hH L$hH D$pH L$hH \$pH D$hH D$PH D$`f D$PH t$xI D$hH \$pH |$ H |$ H J(H9H( T$0H D$0H equivaleH9 overlapsH9 D$0H D$8H \$(H |$@H L$@H L$0H L$HH L$PH D$XH L$`H L$hH L$pH D$xH D$8H v%UH M9,$u L$8H L$PH L$XH L$PH D$ H D$8f |$`H L$HH L$HH L$`H D$ H D$(H D$@H D$(H \$0H D$(H \$0H v/UH l$ M9,$u D$HH t$`1 |$XH |$XH D$HH t$`H9 D$xH L$@H T$Pf L$@H L$PH L$@H L$xH \$81 D$hH D$hH \$pH D$HH D$hH D$hH \$pH D$hH \$pH v@UH l$ M9,$u D$XH \$`H T$@H L$XH T$@H \$`L T$XH T$@I \$`L T$8H T$@H T$8H |$HH L$HH \$(H t$ H9 L$0H L$0H \$(H L$0H v/UH l$ M9,$u |$(H \$ H L$ H T$(H L$ H v/UH ?h2u |$hH L$HH D$HH D$XH D$hH D$hH \$pH t$hH D$hH \$pH L$8H L$PH \$xH D$@H D$XH T$`H L$xH L$xI \$@H L$`H D$hH D$hH \$pH L$8H L$8L D$hH D$hH \$pH D$hH \$pH v(UH l$(f M9,$u v&UH l$(M9,$u v%UH M9,$u D$8H \$'H T$8H \$&H D$%H T$XH t$PH L$HL |$GH D$PH L$HH D$`@ |$hL D$FL D$pH t$`H D$FA T$GL =2~j 8h2uA http/1.1H9 |$0H D$HH L$XH T$HH \$PH t$ H t$(H t$ H t$HH L$XH D$HH T$0H D$HH T$0H v/UH l$ M9,$u |$0H D$HH L$XH T$HH \$PH t$ H t$(H t$ H T$HH L$XH T$0H v/UH l$ M9,$u \$hH |$xH |$ D |$0D |$@H T$ H L$0H \$(H t$@L D$HH |$81 |$ D |$0D |$@H T$ H L$0H \$(H t$@L D$HH |$8H |$ H t$(L |$ H t$(L v,UH D$PH v,UH D$PH v&UH =Vqj T$0H L$0H vKUH D$0H D$0H D$xH \$HH D$pH \$XH L$xH L$pI T$PH L$8H T$PM T$8H D$hH T$@H \$`H T$@H \$`I D$hf =5rj =Wqj |$ H t$(L D$0L |$ H t$(L D$0L \$XH D$0H t$0H D$(H \$ H =Tpj L$8H D$(H L$8H \$ H D$Xf T$(H \$8H L$hH D$XL D$@I L$0I D$XH L$hH T$(H \$8M L$0L D$@M vNUH \$0H D$(H L$(H |$ H |$ H P H9P D$ H |$8L9 D$8H L$HH D$8H |$8H rpH9 D$ H T$HH |$8L D$ H9 5G/h =zcj =(^j |$TH D$Tf T$`H \$xH \$xH |$ H t$(L D$0L |$ H t$(L D$0L L$PH L$8H D$XH \$@H \$HH |$hD |$xH D$xH L$PH L$hH D$hH \$01 D$HH T$@H T$8H D$HH vxUH L$(H L$(H T$ H t$(H v1UH l$0M9,$u |$0H \$8H D$PH L$HH |$HH \$(H D$@H T$(H T$@I \$8H D$PH D$`H \$HH D$hH \$PH |$hH t$PL T$`L \$hH L$PH D$`L D$XH L$pH |$pH t$XL T$`L \$pH L$XH D$`L 8tcp4t 8tcp6 L$pH D$XH L$xH 526* T$8H L$8H =iIj T$XH T$xH T$pH D$`H T$@H L$@H T$`H T$PL D$hH T$HH L$HH =CFj T$hH T$PH |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L T$hI D$8H t$xH L$PH |$pH \$HH T$hH L$0H D$XH \$@H D$`H L$0H D$XH D$ H T$`H L$@L L$XM L$8M L$PH D$HH T$pH \$XH |$pH |$pH \$XH t$HH L$PH D$hH \$HH L$PH9 t$XH t$X@ \$HH |$XH T$pL T$pH |$XI \$HL D$HH D$hH L$PH \$hH L$HH \$@H D$`H L$@H L$`I T$HH T$PI |$ H t$(L |$ H t$(L dt,H "H=- 2H=1 t"H= \$`H D$XH L$XH T$`H |$8H L$8H D$@H T$`H =%6j :chun du}H =a5j :chunu :chunu =Z4j >HEAD@ |$(H T$`H |$(H |$(H T$`H |$(H L$0H |$(H T$`H |$(H |$(H T$`H |$(H :CONNu :HEADtc :DELEu TEtK :SEARu`f CHt; :OPTIuDf ONu< PROPFINDH9 D$hH T$`H L$HH =j.j L$hH L$hI T$`I L$HH D$PH \$81 L$7H L$@H L$HH D$HH9 D$H1 L$HH L$`H D$XH L$XH L$XI |$pD L$pH D$xH D$XH L$XH L$XI L$`H =O*j D$XH L$XH L$XI v(UH l$ f M9,$u D$`H \$hH L$ H D$HH L$`H D$hH D$(H \$0H T$@H L$ H L$ H ;chunu keu >POSTt- >PUu >PATC identityH9 >GEu >HEADu >chun \$`H L$`H L$XH D$xH L$XH t$hH D$@H L$HH T$hH D$@H L$HH T$hL \$PH D$pH 8Traiujf leub Content-H9 Lengu9f thu1 D$pH \$PH T$@H L$HH9 D$hH D$pH \$PH T$@H L$HH =W!j D$pH D$hH \$@H L$HH L$hH |$@H t$HA D$.L D$hL D$HH :chun t$xH L$xI t$`H T$8H L$8H T$`I :CONNf ECup \$hH T$PH L$HH T$PH \$hH L$pH D$@H |$HH \$hH L$pH T$@H D$hH \$pH L$XH \$0H T$@H L$XH T$@H \$0D D$hH D$hH \$pH 8chun duuH L$XH \$0H \$hH D$hH D$hH \$pH D$hH \$pH D$hH D$hH \$pH D$hH \$pH |$HH \$hH L$pH \$hH L$p1 L$8H D$hH \$pH vtUH |$xH T$XH \$`H T$XH D$@H \$HH L$PH D$HH L$PH T$xH D$@H \$HH L$PH D$@H \$HH L$PH |$ H |$ H vMUH M9,$u D$0H L$0H |$@H |$HH T$PH |$@H D$XH |$PH |$`H |$hH L$@H T$HH D$`H \$XH L$PH T$4H \$HH L$PH |$XH t$@D T$4f >HEADuNH \$@H t$8H |$HL cv1f t$4f >HEADt!H t$HH t$pH t$xH t$pH t$pH t$xH t$pH L$pH D$xH L$8H L$pH D$xH L$pH t$xH L$pH t$xH D$pH t$(H T$@L D$0H T$pH T$pH L$@H |$PH D$@H T$PH D$XH \$8H D$HH T$8H L$HI |$PH L$PH D$XH \$8H D$HH L$8H L$HI \$HH >HEADu |$@H t$`H L$PH \$HH T$hL D$pI L$XI L$PH T$hH \$HH t$`H |$@M L$XL D$pH D$xH T$xH D$@L D$`M L$PH T$hH \$HD |$ H t$(D |$ H t$(D D$PH \$XH L$`@ |$hH T$0H T$8H t$(H D$ L D$0H t$(H T$8H D$ H t$(L D$0H T$PH T$XH L$(H D$8I D$(H D$(L D$8I L$(H L$0H D$PD |$8H L$0H T$(H L$HH t$XH t$8H t$`H D$hH L$HH T$(H D$PH L$@1 D$xH L$8H \$(H D$0H 8Trai Content-H9 Leng tht? D$0H \$(H T$`H |$@D |$PH L$@H D$HH D$0H L$PH D$XH L$`H D$0H \$(H \$xfD |$0H T$@H \$xH T$@H \$xH t$HH t$PH t$HH D$0H T$XH D$(H \$0H L$8H D$(H \$0H T$XH D$(H \$0H L$8H D$(H \$0H L$8H v/UH l$ M9,$u D$HH D$(H9 L$0H \$ H H90u \$ H L$0f \$ H t$Hf t$HH D$ H \$0H D$HH D$(H \$ H L$0H |$Hf H97u \$ H L$0H D$(H L$0H \$ H D$8H rYH) |$ H t$`H |$@H \$HH \$HH t$`H |$@f |$pD |$xD T$pH D$pH L$`H \$@H L$`H \$@H t$ H t$0H T$PH T$ H T$0H L$PI t$(H t$8H T$XH T$(H T$8H L$XI |$xH |$PH T$hL T$pL T$hL D$@H L$`H \$HH D$@1 D$@H \$HH L$`H= \$PH T$xH D$PH \$XH T$xH \$XH D$PH D$PH \$XH v/UH l$ M9,$u L$ H L$ H T$(H v/UH l$ M9,$u L$ H L$ H T$(H v/UH l$ M9,$u L$ H \$HH L$ H \$HH T$(H v/UH l$ M9,$u v4UH D$hH |$8D |$HH L$8H D$@H D$0H L$HH D$PH |$8D |$HH L$8H D$@H D$0H L$HH D$PH \$HH \$HD T$ H t$(H |$H@ D$hH T$HH \$PH \$pH T$(H L$ H T$hH D$hH L$ H T$(H \$pH9 T$hH D$8H T$pH T$@H t$8H \$0H D$0H D$0H L$0H L$8H D$XH \$`H L$hH \$@H D$0H T$0H D$(H L$8H \$ H T$ H D$ H \$8H D$(H |$ H |$ H |$@H t$@L |$@H H9D$@u T$XH t$`H T$XH t$8H T$0L T$(M r H T$0H t$8L r H T$0H t$8L D$'H |$hf \$hH L$pD |$xD T$xH T$hH \$PH v,UH D$PH 80t; D$'H v/UH \$8H L$@H L$@H \$8H L$@H \$8H :httpu* D$@H \$HH |$ H T$ H |$ H H9D$ u |$8H L$8H L$@H L$(H D$0H L$(H D$0H >httpu >httpu D$FH \$`H \$`D \$XH \$XD |$PD D$FH |$PD D$Ff t$F@ \$pH \$pH t$F@ D$xH L$xH L$xH L$xH \$ht \$hH \$hH L$hH L$hL D$xH L$hH \$hH \$hH L$HH L$HH v'UH v,UH l$0f M9,$u D$pH \$xH L$XH |$8D |$HH L$XH L$HH D$8H D$8H \$01 v'UH v"UH D$@H D$@H =fx4 \$ H L$@H D$(H t$@f T$ H T$ I t$(H D$0H \$8H |$HH L$@H D$@H T$8H 5:v4 T$8H 8GEu[A 8HEADt< 8TRACu2A Et$f 8OPTIu T$8H D$@1 T$@H \$8H |$HH |$pH D$`L D$hL D$`L |$@L D$@L |$@H H9D$@u L D$Hf D$PH \$PH \$XH T$pH |$ H |$ H v/UH l$ M9,$u T$`H \$HH \$HH |$pH T$xH t$PH t$@1 t$@H L$(L |$X1 D$ L D$8L D$ H L$(H t$@H D$8H D$ H L$(H t$@H L$XH |$(1 D$ L D$0L D$ H L$XH t$@H D$0H D$ H L$XH t$@H D$(H D$(H t$PH9 D$8H \$@H L$HH L$@H T$HH T$HI t$8I L$@I D$ H L$@H \$ H t$8H T$8H L$@H L$ I L$ H D$@H \$HH |$ H t$(1 T$ H D$8H \$@H L$8H \$@H T$ H T$ H v3UH D$XH \$`D |$ D |$0H L$ H D$(H \$0H L$XH \$`H L$@H L$`H D$8H T$ H |$(H t$0A T$@H D$8H vQUH D$HH \$PD |$(f D$(H \$0H v-UH D$pH \$xH \$xH D$pH D$pH \$xH \$PH L$XH D$pH D$pH \$xH D$pH D$pH \$xH t$hH L$XH \$PH t$hL \$`L T$`H T$hH D$pH \$xH T$HH T$FH t$F@ \$xH D$pH D$pH \$xH v/UH l$ M9,$u T$PH D$HH T$`H L$PL T$H1 D$EH L$pH L$pH D$EH L$PH T$HI D$CM |$HH t$PL L$DH T$`H D$XL L$PL T$HI L$XH T$BE T$hH D$FH D$FH T$XH T$`H D$EH D$EH v%UH M9,$u v/UH l$ M9,$u L$(H \$PH L$(H \$PH L$ H T$0H v/UH l$ M9,$u ~ H9z D$xH T$@H T$@H L$8H T$HH t$(L D$0I T$(L D$0L L$8H9 L$HI \$8H9 \$pH L$xH \$HH \$HH D$8H \$PH \$PH D$@H |$ H t$(L D$0L |$ H t$(L D$0L L$ H L$ H T$(H v/UH l$ M9,$u L$0H L$0H D$ H D$(H D$ H T$8H v/UH l$ M9,$u |$pH L$XL D$ H D$ L L$XL T$`L T$hL T$`L \$(H L$0H |$8H t$@L D$HL L$PH T$pH T$pH |$ H t$(L D$0L |$ H t$(L D$0L v/UH l$ M9,$u L$HH L$HH |$PD |$`D |$pH L$@H L$@H D$(1 T$(H \$XH L$`H |$hL D$xH D$0H \$8H D$0H |$ H t$(L D$0L |$ H t$(L D$0L L$hH |$@L L$hH |$@H D$`H L$`H L$xH \$81 D$6M \$HH D$6L D$pH D$pH D$PH D$PH D$pH D$XH D$XH D$pH D$pH |$ H t$(L D$0L L$8D |$ H t$(L D$0L L$8D v+UH T$HH T$HH D$xH \$xH D$pH L$PH L$PH v/UH l$ M9,$u D$PH L$PH T$PH T$XI L$PH L$PI T$XI D$ H L$ H D$(H D$0H D$(H T$8H v/UH l$ M9,$u |$`H t$hL D$pL L$xL D$XH \$PH T$PH \$XH \$XH L$PH \$`H L$hH |$pH t$xL \$`H L$hH |$pH t$xL T$xH T$xH T$(H D$`H T$@H+T$PH T$`H T$(H T$(H T$(H T$@H t$PH D$`L T$ H \$8H t$HH |$XL L$hL D$@L L$HH |$8H t$hH \$XH L$@H D$PH9 L$8H D$PH \$0H T$ H t$@H+t$PH t$`H T$ H t$ H D$pH L$8H T$ H D$pH t$8H |$ H t$(L D$0L L$8D |$ H t$(L D$0L L$8D v/UH l$ M9,$u =||i =/|i =@{i |$ H t$(L |$ H t$(L |$0H D$8H D$(H L$@H D$(H L$@H D$HH \$PH \$XH D$ H D$ H \$XH D$HH \$PH D$8H v4UH :http M9HPu =-qi 8http =~mi =xli :socku fA s5t2I :sock ="ji :httpf =hhi :http :http =|`i =V_i =[^i =8Xi =xWi =rSi =rRi |$ H t$(L D$0L L$8L T$@D |$ H t$(L D$0L L$8L T$@D v%UH M9,$u v%UH M9,$u L$8L L$PH D$HH L$8H D$@H |$`H |$hH D$`H L$XH L$xH L$PH \$@H L$`H |$@H t$hH =\Ni L$PI v%UH M9,$u D$XH L$ H D$@H \$(H L$ H =~Li T$0I D$8H \$XH L$@H =.Li L$8I v%UH M9,$u v/UH \$@H D$ H T$ H \$`H L$hH D$@H T$@H T$8H L$hH \$`H L$hH \$`L T$8H |$(D |$8H D$`L T$HH L$`H :httpt :httpuG su5H :httpf t$Hf t$HI |$(D |$8H T$ L d$(L T$0L \$8D L$@H L$ H |$(H t$0L D$8H vfUH \$ H D$(H \$ H T$ H9 D$(H L$/H |$0D |$@D |$PD |$`H L$0H D$8H L$@H L$PH D$XH L$`H D$hH |$ H t$(L D$0D |$ H t$(L D$0D \$hH D$`H \$0H D$(H L$HH D$(H L$HH D$(H L$HH \$0H T$`H) |$8H L$8H D$@H T$ H L$0H L$0H D$ H D$(H D$ H T$8H v/UH l$ M9,$u v|UH T$ H \$XH L$`fD T$0H L$`H \$XH L$`H T$0H \$XH t$ H t$(H t$ H T$8H v/UH l$ M9,$u |$8H L$PH T$ H t$(H T$0H t$(H D$ H T$8H T$8H v/UH l$ M9,$u D$pH \$xH T$xH t$8H T$xH t$8H \$0H D$(H D$(H T$pH9Jxu8H D$PH L$XH D$pI9PxtSD |$@H |$@H T$HH L$PH L$XH |$ H |$ H |$hH D$AE |$hH L$hH d$AE l$AL ?HEADA |$AE D$AD |$AE D$@H D$pH =d7i T$pH T$pI T$pL T$pI l$0M D$0L |$AE D$@t \$X1 T$xH D$@f \$`1 D$AH T$pL \$P1 T$pH T$AH \$D1 t$@@ L$?1 T$BH T$@H T$xH \$PH D$HH t$0H |$(H T$ H D$HH D$01 D$HH \$PH v7UH v%UH M9,$u T$0H T$ H t$0H t$ H tGH9 \$(H \$(H L$ H v5UH B0L+B( 8HTTPu 408 |$(D T$(H D$0H \$8H T$@D |$XD |$hD |$xH T$XH D$hK T$`H T$(H T$pH |$HH \$HH L$PH v,UH D$PH D$pL \$xH D$pL D$pH L$8H L$xH L$XH \$ H D$0H |$8H duHH |$8H D$0H L$XH \$ H |$8L cwxH etrH L$pH L$XH \$ H T$pH D$@L L$(f T$xH D$0H L$XH \$ H T$pH t$PH L$PH =I%i T$(f T$(I T$@H H9r(t D$HH t$0H L$XH \$ H |$ H t$(L D$0L |$ H t$(L D$0L \$8H D$0L F0L+F(L9 T$0H F0L9F(u \$81 T$pL d$@f l$xL L$hI T$PH L$`H D$hH D$PH \$`H L$@H H9NxuGH \$XH D$HH L$HH L$XH D$pH \$HH L$@H T$@H |$PD |$`D |$pH \$HH \$pH \$3H \$xH L$`H T$PH D$PH \$41 D$2H D$2H D$2H D$2H v%UH M9,$u v%UH M9,$u |$PH |$@H |$`D |$pH L$pH L$@H L$xH T$`H D$`H \$81 D$6H D$6H D$6H D$6H v@UH l$ M9,$u vEUH \$0H >HEAD \$XH D$3H uiH D$3H D$3H D$3@ \$XH L$xH L$HH \$41 D$PD L$HH |$PH v@UH l$ M9,$u v%UH M9,$u vsUH \$XH L$`fD T$0H L$`H \$XH L$`H T$0H \$XH t$ H t$(H t$ H T$8H v/UH l$ M9,$u D$hH \$@H L$HH |$PH t$XL D$`L L$hD T$pH vCUH D$xH T$xH L$XH |$HH D$`H \$PH |$`H t$PL T$XL \$`H L$PH D$XL |$hH |$HH T$@H T$@H L$8L T$(D \$&H T$@H L$8L D$0H \$HH L$PH D$@f |$XH |$`H |$XH |$HL D$PH D$HH \$PH D$HH T$hH D$0H \$HH L$PH T$HL L$PH D$0L \$HH L$PH D$0H D$0H \$HH L$PH v/UH l$ M9,$u |$@H |$ H L$XH t$0H t$8H t$0H A H9 L$XH L$XH D$ H T$@H D$ H \$(H D$ H T$@H D$ H \$(H T$@H \$(H D$ H D$ H \$(H v/UH l$ M9,$u D$PH \$XH L$`H |$hH L$8H D$(H L$(1 T$PH L$`H \$XH |$hH L$`H \$XH t$PH |$hH D$0H T$ H L$`H T$ H \$XH t$PH |$hL D$0H |$ f D$8H \$@H L$8H L$8H \$@H L$@I D$ H T$8H T$8H L$ I D$ H L$ H L$@H \$8H L$@H \$8H L$@H \$8H L$@H \$8H |$ @ vUH l$0f M9,$u M9,$u t$(L D$0L L$8L T$@H t$(H T$ H l$ M9,$u l$(f M9,$u v[UH t$(L D$0L L$8L L$ L L$ L M9,$ v>UH l$0f M9,$u M9,$u T$,f T$.H L$0H D$8H l$PM9,$ T$,D |$0D L$0H L$@H D$HH l$`M9,$ M9,$u t$(H T$ H l$ M9,$u l$(f M9,$u v3UH l$ M9,$u v>UH l$0f M9,$u M9,$u v5UH l$8M9,$u l$ M9,$u M9,$u l$ M9,$u v9UH l$0M9,$u vBUH l$(f M9,$u vMUH \$@H L$HH M9,$u v6UH l$(M9,$u M9,$u vMUH \$@H L$HH M9,$u t$(H T$ H l$ M9,$u l$(f M9,$u v3UH l$ M9,$u v>UH l$0f M9,$u M9,$u t$(D D$,H t$(H T$ H l$ M9,$u l$(f M9,$u vEUH t$(D l$ M9,$u v>UH l$0f M9,$u M9,$u t$(D D$,H t$(H T$ H l$ M9,$u l$(f M9,$u vEUH t$(D l$ M9,$u v>UH l$0f M9,$u M9,$u t$(L D$0L L$8L T$@H t$(H T$ H l$ M9,$u l$(f M9,$u v[UH t$(L D$0L L$8L L$ L L$ L M9,$ v>UH l$0f M9,$u M9,$u D$(H \$0H L$8H |$@@ t$HH l$(M9,$u M9,$u v`UH D$ H \$(H L$0H |$8@ t$@H |$ @ t$(f l$ M9,$ v@UH M9,$u |$ @ t$(H M9,$u M9,$u veUH D$0H \$8H L$@H |$H@ t$PH |$ @ l$0M9,$ vEUH l$0M9,$u |$ @ t$(H M9,$u M9,$u t$(D D$,D L$0D T$1H t$(H T$ H l$ M9,$u l$(f M9,$u M9,$u M9,$u v[UH t$(D D$,D L$0D M9,$ v>UH l$0f M9,$u M9,$u v+UH M9,$u \$XH L$0H \$(H D$ H T$8H D$ H \$(H L$0H M9,$ M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u \$(f l$ M9,$ v@UH |$ H |$ H t$(f l$0M9,$u \$(H M9,$ vFUH D$0H \$8H L$@H |$HH t$PH |$ H t$(L D$0L |$ H t$(L D$0L l$0M9,$ v)UH \$8H l$0M9,$u vDUH D$(H \$0H L$8H |$@H t$HL D$PH |$ H t$(L |$ H t$(L l$(M9,$ v/UH \$0H L$8H M9,$u v4UH \$0H L$8H l$(M9,$u vJUH T$ H T$ H l$8M9,$u M9,$u M9,$u v`UH L$(H D$0H M9,$u M9,$u T$(H T$PD |$0D L$0H D$8H D$PH L$@H D$HH l$hM9,$ vcUH L$(H D$0H M9,$u vcUH L$(H D$0H M9,$u vcUH L$(H D$0H M9,$u vcUH L$(H D$0H M9,$u t$(L D$0L L$8L T$@H t$(H T$ H l$ M9,$u l$(f M9,$u v[UH t$(L D$0L L$8L L$ L L$ L M9,$ v>UH l$0f M9,$u M9,$u t$(L D$0L L$8L T$@H t$(H T$ H l$ M9,$u l$(f M9,$u v[UH t$(L D$0L L$8L L$ L L$ L M9,$ v>UH l$0f M9,$u M9,$u t$(D D$,L L$0L T$8L \$@H t$(H T$ H l$ f M9,$u l$(f M9,$u v_UH t$(D D$,L L$0L T$8L T$ L T$ L l$ M9,$ v>UH l$0f M9,$u M9,$u v@UH \$0H L$8H l$(f M9,$u M9,$u l$ M9,$u v9UH l$ M9,$u v@UH M9,$u D$hH D$HH T$PL d$XL l$`H t$hL D$pI M9,$ T$,H T$0H T$hD |$8D |$HD L$8H L$HH D$PH D$hH L$XH D$`H M9,$ v+UH M9,$u v3UH l$0M9,$u M9,$u M9,$u M9,$u M9,$u M9,$u v+UH l$ M9,$u =jZh l$(M9,$ M9,$u v5UH \$ H L$(H M9,$u I H9 M9,$u vKUH \$@H L$HH M9,$u M9,$u v3UH \$0H L$8H l$(M9,$u M9,$u v@UH \$0H L$8H l$(M9,$u M9,$u v4UH \$0H L$8H l$(M9,$u M9,$u v7UH \$(H L$0H l$ M9,$u M9,$u v3UH \$0H L$8H l$(M9,$u M9,$u vAUH \$0H L$8H l$(M9,$u v`UH T$ H T$(1 T$ H l$@M9,$ v*UH \$ H M9,$u v$UH M9,$u v8UH D$0H \$8H L$@H |$ H |$ H M9,$u v)UH \$8H l$0M9,$u vbUH T$8H T$@H D$@L L$8H l$Xf M9,$u v4UH \$8H L$@H l$0M9,$u l$8M9,$u D$XH D$@H T$HL \$PL d$XH t$`I |$ f l$xM9,$ v4UH \$ H L$(H |$0H M9,$u v$UH M9,$u v4UH \$ H L$(H |$0H M9,$u v$UH M9,$u vFUH D$0H \$8H L$@H |$HH t$PH |$ H t$(L D$0L |$ H t$(L D$0L l$0M9,$ v)UH \$8H l$0M9,$u v4UH \$ H L$(H |$0H M9,$u v$UH M9,$u vFUH D$0H \$8H L$@H |$HL L$`H |$ H t$(L D$0L |$ H t$(L D$0L l$0M9,$ v)UH |$HH l$0M9,$u vFUH D$0H \$8H L$@H |$HL L$`H |$ H t$(L D$0L |$ H t$(L D$0L l$0M9,$ v)UH |$HH l$0M9,$u vFUH D$0H \$8H L$@H |$HL L$`H |$ H t$(L D$0L |$ H t$(L D$0L l$0M9,$ v)UH |$HH l$0M9,$u M9,$u vFUH D$0H \$8H L$@H |$HH t$PH |$ H t$(L D$0L |$ H t$(L D$0L l$0M9,$ v)UH \$8H l$0M9,$u vKUH t$0L D$8L L$@H D$ H t$ L D$(L t$ L D$(L M9,$ v$UH M9,$u vKUH t$0L D$8L L$@H D$ H t$ L D$(L t$ L D$(L M9,$ v$UH M9,$u v:UH \$0H L$8H l$(M9,$u M9,$u vUUH \$PH L$XH l$HM9,$ v3UH l$0M9,$u M9,$u vYUH l$0f M9,$ \$HH \$HH t$ H |$(L D$HA |$ f l$@M9,$ vKUH |$ f l$8M9,$u vaUH |$(H T$(L D$0H M9,$u M9,$u v/UH \$ H L$(H M9,$u v%UH M9,$u v=UH D$0H \$8H L$@H |$HH |$ H t$(L |$ H t$(L l$0M9,$u v*UH \$8H l$0M9,$u v*UH \$ H M9,$u v$UH M9,$u M9,$u M9,$u M9,$u M9,$u v4UH \$ H L$(H |$0H M9,$u v%UH M9,$u vFUH D$0H \$8H L$@H |$HH t$PH |$ H t$(L D$0L |$ H t$(L D$0L l$0M9,$ v)UH \$8H l$0M9,$u vTUH l$ M9,$u vKUH D$HH \$PH L$XH |$ H t$(D D$0D |$ H t$(D D$0D L$1f l$HM9,$ T$PH |$XH T$Xf t$`L D$PM T$8H T$ H t$(I |$0H L$HL T$@H L$HH |$0I T$ H T$(H =n5h L$8I M9,$ v%UH M9,$u v%UH M9,$u M9,$u vIUH D$HH \$PH L$XH t$hH |$ H t$(L |$ H t$(L l$Hf M9,$ v.UH D$(H l$(M9,$u T$HH |$PH T$Pf L$@H |$0H T$XH t$HH t$8H t$ H T$(H T$HH L$@H T$ H T$(H L$8I M9,$ v;UH D$0H \$8H l$0M9,$u vKUH D$HH \$PH L$XH |$ H t$(D D$0D |$ H t$(D D$0D L$1f l$HM9,$ vyUH T$8H t$@H L$(H l$XM9,$u v%UH M9,$u v'UH l$ M9,$u v.UH l$(M9,$u v.UH l$(M9,$u v.UH l$(M9,$u v.UH l$(M9,$u v%UH M9,$u v%UH M9,$u v.UH D$(H l$(M9,$u v%UH M9,$u v%UH M9,$u vFUH D$@H \$HH L$PH |$XH |$ H |$ H l$@M9,$u v%UH M9,$u v%UH M9,$u v^UH D$(H \$0H T$0H T$(H v{UH D$0H \$81 \$8H D$0H D$xH T$xH t$PH t$XH t$PH D$0H L$xf =2'h L$0I \$@H L$HH L$@H \$8H L$(H L$(H \$8H T$`H D$ H L$@H D$ H AsZH D$ H v/UH l$ M9,$u T$ H T$8H T$@H T$8H |$XH L$ H t$XH L$`H L$HH L$PH \$Hf |$(H t$0H L$HH L$PH T$ H t$0H v/UH l$ M9,$u v%UH v,UH =/!h =^ h =( h v$UH L$HH \$@H D$8H t$XH |$PH D$ H D$8H \$@H T$@H D$ H T$HH T$8I \$PH |$ H t$(f |$ H t$(f |$HH L$HH t$`H T$XH T$hH T$xH D$HH L$HH L$HH \$HH L$PH T$HH |$(H L$@H D$xH D$xH \$8H L$@H L$xH \$XH t$`H L$0H D$ H L$ H L$0f L$0I \$hH L$pH D$`H L$pH \$hH L$pH T$`H D$@H T$HL T$HL D$@I L$pL T$pH \$hH D$HH t$(H |$0L L$ f t$(H |$0L L$ I t$ H |$HH9w@} vpUH D$ H ~%vFH L$ H L$ H D$@H \$HH t$ H |$(L D$@L |$(L T$ H }=sZL t$HH9 T$@H L$@H 9w)f }1sEH D$(H L$(H \$xH D$pH \$XH L$PH L$HM D$pH d$@M t$XL D$PE1 L$PH r H T$PH L$8H \$`H D$XD L$7I D$xH D$xH L$@H D$XH L$8H T$PH \$`H L$7L T$HI D$XH \$`H |$XH t$`L \$`H \$`H T$Xf D$XH \$`H \$`r L$8f D$XH L$PH D$XH D$XH \$`H D$XH \$`H \$hH \$pH \$pf |$`H L$`L L$X1 L$`H \$hH D$0H L$0H T$hI L$`H \$pH D$8H L$8H T$pI \$xH D$PH D$@M D$xA D$HH T$XH |$HH T$XH |$HH9{ T$XH |$Hu T$XH |$HH x u t$HH t$HH t$HH T$XH T$XH t$HI L$`H T$XH t$HH t$HH |$HH9 D$~H D$~L T$~L y uNL T$~H z u D$~I r L =m!3 D$~L r L r H D$PH \$XH L$`H D$(H \$8H D$01 |$XH |$0H T$8I t$(H T$PH r H 8null r H 8true 8falsu r H r H |$?H r H r H r H r H D$@H r H |$ H t$(L D$0L L$8D |$ H t$(L D$0L L$8D D$8H D$ H L$HH \$@H L$@H T$HH9 \$xH D$PH D$hH D$PH \$xH x u0H t$pH L$`H L$`H T$XH t$pH L$@H T$HH t$hH D$HH D$hH L$8f L$hH D$8H |$'H \$(H D$@H L$hH y u D$@H L$hH \$(H D$0H \$PH \$HH L$@H L$0H L$PI D$hH x u D$hH D$HH L$HH D$(H T$HH \$0H D$ H T$HH D$ H \$0H |$hD D$xH T$xH L$0H \$X1 L$0H \$XH T$@H t$8H T$`H T$8H T$hH T$@H T$pD |$HH D$`H \$hH t$PH L$pH |$hH D$HH |$HH D$`H \$hH t$PH L$pH D$`H \$hH L$pH |$HH t$PH v(UH l$(f M9,$u v7UH v)UH L$ H L$0H \$(H |$8H L$8H L$ H L$PH L$0H L$HH L$XH L$(H L$pH L$hH L$xH |$@H T$PH T$@H T$XH T$PH \$0H L$8H T$0H T$`L \$HH D$@H D$@H \$HH |$ @ vhUH D$(H D$(H \$0H vsUH \$`H L$hH \$@H D$XH L$8H |$0@ t$/D D$.H \$@H L$8H t$/D D$.I D$XI |$ @ t$(D t$(D vRUH D$(H \$0H r H \$XH \$XH D$0H D$8H T$PH T$0L L$8L T$0I L$8M T$PM |$XH D$PH L$8H D$0H L$PH T$8L |$XH T$8H vxUH \$hH L$pH \$@H D$`H L$8H |$0@ t$/D D$.H L$HH L$HH D$`H \$@H t$/D D$.I L$8A |$ @ t$(D t$(D D$ H L$ I D$0H \$8H L$@H |$HH t$PH L$0H D$pD |$0D |$8D |$HH L$XH D$HH D$(H D$(H L$0H v%UH |$ @ t$(D t$(D D$?H T$`H L$XH \$PH t$PL D$XD |$HH t$xH |$HH t$xH |$HH t$xH L$hH D$@H L$@H L$hH L$HH L$xH L$hI T$xI \$pH |$ @ t$(D t$(D D$?H |$hH \$xH \$PH L$XH t$PL D$XD |$HH |$HH |$HH L$hH L$pH D$@H L$@H L$pH L$HH L$pI L$`H |$ @ t$(D t$(D D$GH T$XH L$xH T$GH t$pH |$PH L$XH D$HH L$`H L$HH L$`H L$PH L$pH L$`I T$pI \$hH |$ @ t$(D t$(D D$GH |$`H \$pH T$GH t$xH |$PH L$`H D$HH L$hH L$HH L$hH L$PH L$xH L$hI T$xI L$XH |$ @ t$(D t$(D L$p@ t$GH \$hH |$XH t$GH |$XH D$HI T$`L L$PH L$pH t$GL D$HL D$HH true D$HH falsB |$ @ t$(D t$(D \$pH L$xH D$h@ t$GH |$HH L$PH t$GH |$HH D$hH L$HH |$ @ t$(D t$(D \$pH L$xH D$h@ t$GH |$HH L$PH t$GH |$HH D$hH w&H u}D L$HH |$ @ t$(D t$(D L$PH T$XH |$pH D$GH L$PH |$FH eu^H D$`H \$HH T$XH L$hH L$pH L$HH L$`H L$xH L$hI T$pI t$`I t$XH L$XH |$ H t$(D D$0D |$ H t$(D D$0D |$hH D$G@ t$FH t$FH |$hD D$GI L$hH L$HH T$xH D$FE |$HL \$PL |$HI \$PH L$XL L$PH \$xH \$PH L$XH9 L$XH \$PH t$FH |$hD D$G@ D$GI \$`H \$pH D$GL \$`I \$pH D$xH |$ @ t$(D t$(D \$PH L$XH D$H@ t$/D D$.H t$/D D$.H L$0H |$ @ t$(D t$(D \$PH rxH \$ H L$ H L$(H D$0H L$ I |$ @ t$(D t$(D \$hL \$`H L$/H d$XN l&PL |&XL |$PL T$HL L$pF D&xE L$/H T$`H \$hH L$pL T$xL \$@L d$XA D$8E L$/H T$`H \$hH L$pL T$xL \$@L d$XA D$8E L$/H T$`H \$hH L$pL T$xL \$@L d$XA T$XH T$XH L$XL \$pH L$xH |$@D D$8H T$`H \$hH T$HH D$PH d$XL |$PH T$HI L$/H T$`H \$hL \$@L T$xL D$HM9 t$0L \$@A r!A T$xL t$0I L$ H |$(H t$0L D$8L L$@L T$HL L$ H |$(H t$0L D$8L L$@L T$HL L$FD D$EH T$xH T$DH t$HH L$xH L$XH t$XH T$XH t$HH9 D$pH T$pH D$HM T$pH t$ED D$FA D$pL D$PH L$`H T$xH \$pH L$`H \$hD L$xf \$pH T$xH L$pH L$xH |$ H t$(D D$0D |$ H t$(D D$0D v+UH M9,$u \$8H D$0H L$0H L$0H \$xH D$pH9 D$pL \$HL T$@H T$XL T$XL T$@L \$HI L$PH |$ @ t$(D t$(D T$@H |$pD L$.D D$-H L$hH D$`H D$XH T$HH T$pH D$hH \$pH D$XH t$0H L$XH L$0H L$XH L$0H L$xH L$xH D$`H L$hH |$pD D$-D L$.L T$,L L$,A L$@H T$hD D$PH \$8H T$@H L$hH L$pH L$8H L$PH L$hI T$pI t$PI D$hH L$@H L$HH |$ H t$(D D$0D |$ H t$(D D$0D v+UH M9,$u \$@H D$8H L$8H D$ H D$8H =xug \$xH t$@H |$XH L$PD L$/D D$.H L$@H \$XH D$PH L$@H \$XH T$01 T$HH D$/H D$xI t$.A D$8H L$@H T$0H \$XH9 D$8H D$8H L$@H |$ H t$(D D$0D |$ H t$(D D$0D vcUH D$(H \$0H =7sg D$`D L$.D D$-H T$@H |$XH D$8H \$HH T$8H T$HH |$hH t$pH t$8H t$xH t$HH t$hH L$PH T$@H t$,H T$`H D$.H T$PD D$HH \$0H T$@H L$PH L$XH L$0H L$HH L$PI T$XI t$HI D$PH L$@H L$@H |$ H t$(D D$0D |$ H t$(D D$0D v+UH M9,$u vcUH D$(H \$0H vcUH D$8H \$@H |$PH t$XA |$ H t$(L D$0D L$8D |$ H t$(L D$0D L$8D D$8H \$@H D$81 D$8H \$@H L$ H9 t$ H 5fr^ L$xH |$ H |$ H D$`H \$hH T$0H L$(H T$0H T$HH T$Hf |$ H t$@H L$ H |$@H L$0H L$HH T$HH T$HH T$HHc T$HH w*H L$HH T$HH T$HH \$8H \$8f |$0D |$8D D$HH D$0H \$8H L$@H |$HH t$PH D$`H \$hH L$pH |$xH L$`H D$XH L$XH D$HH D$0H \$8H L$@H |$HH t$PH T$hD T$hH L$GD \$PH L$XH D$pL \$PH L$XH9 D$HH \$PH D$hL L$`M L$L9 |$ H t$(L |$ H t$(L \$`H9 T$HD T$EL) T$XL L$hL T$XL L$hI \$`H D$hL d$`H L$XH \$`H L$XH9 T$G@ t$FH \u00 L$HI T$HH \$PH T$`L L$hL T$`L L$hI \$PL \$`H L$XH D$hH \$`H T$HH L$XH9 |$GH T$HH u202@ r}L) t$XL D$hH t$XL D$hH \$`H D$hH L$`H T$XH D$hH \$XH L$`H |$ H t$(L |$ H t$(L \$PF d$HM) T$HI! \$xL \$xL T$pL \$PD l$DL \$pL l$FD T$EL T$EL \$PD l$FD |$DI \u00F d$hM) T$hL! \$`L \$`L L$pI \$PD l$DL L$pH T$FL T$FL \$PD l$DI u202F \$pL d$XH D$XH L$PH9 D$pH T$pH T$pH \$pH L$PH T$pH L$PL d$XH D$pH d$XL \$pL \$xL d$HL T$xH T$xL L$xH D$xH L$xH |$ H t$(L D$0D |$ H t$(L D$0D v[UH =/Ug l$(M9,$u D$xH T$DH \$EH u(D D$DH L$xH D$Df D$HH \$xH \$xH \$xL D$xH \$xH t$xH D$DH D$DI T$EE L$Ef ,t_A :uJL D$DI D$DH D$DI L$pH L$pI T$pH T$pH ]tdA {uTL L$EI D$DD L$EI T$hH T$hH \$hH \$hH D$DD L$EI D$xH D$hH T$PH \$hH T$PH L$EH D$DH D$GH L$EI D$GH D$pH D$XH T$pH D$XH D$DI D$xH T$`H \$xH T$`H D$HE1 \$ H L$(H |$0H t$8L D$@L L$HL \$ H L$(H |$0H t$8L D$@L L$HL v[UH l$(M9,$u =_Ig |$@H \$0H D$(H D$(H \$0H L$@H L$@H vPUH =|Gg D$ H L$ H D$pH \$xH T$pH \$xL D$XH \$HH D$P1 |$XH t$HL L$PH T$pH vJUH =YCg =)Cg =nBg =>Bg D$pH D$XH \$HH D$P1 |$XH t$HL L$PH T$pH vpUH }u-H D$pH D$XH \$HH D$P1 |$XH t$HL L$PH T$pH =^>g w>t D$pH :u4H D$XH \$HH D$P1 |$XH t$HL L$PH T$pH ,u2H =eE D$HH t$xL T$?D T$>H t$xH l$0A T$8H D$pI T$@H D$pI \$>H t$xI T$pI \$XI \$hf D$`H t$PH T$hL T$`L9 T$@H T$hL T$@L9 t$xH |$ H t$(L D$0L |$ H t$(L D$0L \$(H9 |JH9 |)H9 |TH9 \$(H9 |TH9 \$(H l$PL |$HH l$xN \$pN \$hN \$`H D$XH t$xL D$PL L$pL D$PH t$hL D$HL L$`L D$XL l$PI L$@H |$ H t$(L |$ H t$(L \$(L9 \$0I) D$hH L$xH \$pI) D$HI T$PI T$@H T$@H D$hH L$xH \$pH D$HL T$PH T$8D T$8I T$hL \$pH L$xH |$ H t$(L |$ H t$(L \$(H vXUH D$(H \$0H \$08S vXUH |$ H l$@M9,$u T$XH L$PM L$PH T$XH \$PM \$pH T$XL d$HH T$XH \$pH \$PL T$XH \$pH d$HH9 \$pM T$XL T$XH d$HH T$XL d$HM T$XH \$pH d$HM \$Pf L$`H T$XH \$PL d$HH \$`H D$XH d$HL |$PH D$XH thH9 d$HA d$HA L$HH d$HH |$@H D$XL d$HH D$XH T$@L d$HL _ H) \$hH T$XH T$XL \$HI \$Hf D$xH T$xH L$XL L$XH9 L$XL L$@L \$HH T$XH \$hH \$HH9 T$hH L$@H T$@H T$XL \$HL T$XH \$HH L$@H L$XH9 L$HH L$HH =6\d \$PH L$2@ |$3@ t$4D D$5fD L$6H T$0H t$$D D$%D L$&H L$*@ |$+@ t$,D D$-fD L$.H T$(H t$$D D$%D L$&H T$$H T$ H JrrD Ks!A \$(f vSUH \$(f vSUH =vPd =>Pd D$(H \$(H \$(H =?Od L$(I D$ H L$@H D$HH L$0H D$8H =ENd D$HH L$hH L$HH L$pH L$XH L$HH L$`H T$HH D$8H L$ H L$PH L$(H) t$0H L$(H L$0H T$PH =_Kd D$@H L$hH D$pH L$XH D$`H \$8H D$ H |$hH T$PH T$PH L$HH L$HH t$hL D$pH L$2H >http =}Fd =TDd T$PH L$2E L$@L \$XH T$XH9 T$XH L$@H D$xI |$hH t$pH L$`H T$8H =uAd L$`I L$8H L$hH L$`H |$hH t$pH L$HH L$HH L$HH T$PH |$hH t$pH L$hH L$xH D$HH L$hH =R>d \$HH |$HH D$XH L$xH L$`H \$81 L$xH T$XL T$@H \$pH |$PH \$pH |$PL T$@H v%UH M9,$u T$pH t$HH L$hH D$@H D$@L L$hM |$`L t$HH |$`L D$HH D$xH \$PH L$hH \$PL L$HH \$XH L$HH L$XH =e9d t$pI v'UH l$(M9,$u v'UH l$(M9,$u \$HH D$@H |$XH L$PH \$HD |$ H L$ H T$(H t$@H L$PH \$HH |$XH |$ f \$`H D$@H L$XH |$`@ T$XH =_6d \$0H T$ H \$8H D$(H D$(H \$8H T$ L D$XI =R5d T$0I T$@H v]UH D$(H \$0H T$(H t$0H9F vsUH D$(H \$0H T$(H t$0H9F vFUH D$0H \$8H L$@H |$HH t$PH |$ H t$(L D$0L |$ H t$(L D$0L l$0M9,$ v*UH \$8H l$0M9,$u vFUH D$0H \$8H L$@H |$HH t$PH |$ H t$(L D$0L |$ H t$(L D$0L l$0M9,$ v)UH \$8H l$0M9,$u M9,$u M9,$u M9,$u D$pH D$xH L$pH D$xH D$HH L$xH T$pH L$xI T$pI \$HH L$HH T$xI L$HH t$pH =A(d D$@H \$hH L$pH L$`H T$hI T$pH D$XH t$`H L$@H L$hH L$pH T$pH D$PH |$x1 D$P1 L$?H D$PH t$H@ |$>H D$@H L$PH |$hD |$xH L$@H T$hH T$pH D$xH t$hA T$XH T$`H |$XH L$XH D$`H t$XA D$pH \$xH L$XH |$8D |$HH L$8H D$@H D$pH \$xH L$HH D$PH \$XH t$8A |$ H t$(D |$ H t$(D v|UH D$(H \$0H T$(H t$0H9F \$08S u I!8K! viUH P 8S u8H D$(H \$0H T$0H T$(H =4'd |$xD L$xH |$hH D$hH \$pH |$xD L$xH |$hH D$hH \$pH |$hH L$hH D$pH |$xD L$xH |$hH D$hH \$pH |$ @ t$(D t$(D D$hH \$pH L$xH |$(D |$8D |$HH D$hH L$(H D$0H L$8H L$@H D$xH L$HH D$PH D$hH \$pH |$ @ t$(D t$(D D$HL D$0L D$XL L$(H D$XH D$hH L$(H |$@D |$PD |$`D |$pM |$@D |$PD |$`D |$pH T$@H L$PH t$`H D$pH D$@H \$HH L$PH |$XH t$`L D$hL L$pD T$xD \$ H L$(H |$0H t$8L D$@L \$ H L$(H |$0H t$8L D$@L L$hI L$hH D$pH \$xH |$ H t$(L D$0L L$8D |$ H t$(L D$0L L$8D D$pH \$0D |$@D |$PD |$`H L$@H D$HH L$PH L$XH D$pH L$`H D$hH \$(H D$8H D$pH \$0D |$@D |$PD |$`H D$8H T$@H D$HH T$PH T$XH D$pH T$`H D$hH |$ H t$(L D$0L L$8D |$ H t$(L D$0L L$8D \$pHc T$pL T$pH D$xD T$oL T$pL T$oL D$xH T$nH T$pL T$nD \$oL D$xH \$mL T$pL \$mL T$@H T$@H \$(H T$pH T$pH L$(1 L$xH D$`H D$HL L$PL D$XL L$`L D$hD \$0H t$8H L$(H \$0H T$HH D$HH D$HH T$@L D$HL |$pA D$xA \$XL \$PH T$@L L$X1 T$@L \$PL T$hD |$xH T$pH L$HH T$hH9 \$hH \$hH T$@H L$HH \$hH \$`H L$XH \$`L L$(H |$PD |$`D |$pH D$(H L$PH D$XH L$`H L$hH D$8H L$pH D$xH M9,$ v5UH l$(M9,$u v{UH D$pH D$@H \$HH L$PH |$XH t$`L D$hL L$pD M9,$ vpUH P 8S u? P!8S!u6H D$(H \$0H T$0H T$(H v}UH |`H L$xH D$xH 8mod A 8dep A |$hH L$pH) XpM9 T$`L T$`H \$XH JXH9 t$XH L$HH L$HH D$PH D$PH L$HH |$(D |$8H L$(H D$0H L$HH T$8L D$@H T$HH L$ H L$ H L$(H D$0H L$(H9 D$0H S(H9P(u_H P0H9S0uUH D$(H \$0H T$0H T$(H T$0H T$(H v^UH D$(H \$0H T$0H T$(H D$ H T$ H D$(H \$0H T$(H t$0H9F T$(H H9F(u8H T$(H t$0H9F8t t$ H \$@H D$8H L$@H L$8I vdUH l$(M9,$u vNUH P H9S u D$(H \$(H \$(H \$(H D$(I |$2D |$8D |$HH |$2D |$8D D$HH D$2H 9amd6u 9arm6u 8v1t 8v2u: 8v3t 8v4u 8ofuW 8lateuAf u0H certifieH9 inprocesH9 \$(H D$0H \$(H \$0H T$/H L$8H L$.I T$HL D$PH T$XH T$`H T$/H D$h1 L$.H T$/H D$h@ T$/H 8v8.0u t$.1 8v8.1 8v8.2 8v8.3 8v9.0tt 8v9.1tl 8v9.2tb 8v9.3tZ 8v8.4tD 8v8.5t< 8v9.4t2 8v9.5t* 8v8.6t 8v8.7t 8v8.8t 8v8.9u T$8L D$@H T$HH T$PH T$/H t$.H v`UH u5H hardfloaH9 softfloa u5H hardfloaH9 softfloa poweu powe r9u2 8poweu rva20u64H9 rva22u64H9 D$(f \$8H T$6H ?satcu ?signu |$HH L$HH D$PH D$@H \$(H L$0H L$(H t$0H9 D$HH \$8H D$@H D$HH L$(H \$8H T$(H |$@H t$0H) D$@H \$(H L$0H D$pH \$XH T$`H \$XH t$@H L$HH D$pH T$@H L$HH9 t$`f \$PH D$hH D$`H D$hH \$PL 6u~H ;amd6u ;arm6uV T$@1 ;ppc6 ;mips ;wasm L$PH L$PH ;ppc6u f ;risc mips64leH9 mips mips D$xH D$xH L$XH L$XH T$@H t$HH9 L$`H L$`H D$@H L$pH L$pH L$hH L$hH 9amd6u 9arm6u 9ppc6uY 4tLf 9loonu 9ppc6u 9riscu 938u 6t^f 9aru^ 9amd6u 9arm6 9ppc6u+ 9ppc6u D$|H T$}H L$}H L$}H 9noneu 9no@ t${@ |$ H t$(L |$ H t$(L v-UH l$0M9,$u T$pH L$xH t$pA \$hH t$hL vSUH D$XH L$hH |$pH D$@H \$8H L$8H =d7# |$ H t$hH |$`H D$xH L$`H L$hH T$xH \$xH =s2& L$HH L$HH L$PH D$pH L$PH9 D$XH os/execH T$7H os/exec.H T$8H Command(H T$@H L$XH9 rtH) t$PH) t$pH D$PH T$XH D$pH \$xH |$ H |$ H t$(f D$`H |$@H \$hL |$@L D$`I \$hH L$`L L$XL T$XH T$`H L$XL \$PL T$PH T$XH T$xH D$`I \$pL D$`H T$xH |$HH T$xH |$HL D$`L \$pL L$XL |$HL L$XI v{UH D$8H \$@H L$HH |$PfD D$pH D$PH \$HH T$pH T$pH D$PH \$HL T$pH D$PH \$HL T$HL T$HI D$pM D$XH T$pH D$XI D$P1 T$pH D$@L T$pH D$@H 5$D. \$HI :writuc euYH :|1u?H D$XH \$@H L$HH D$PH \$8H D$PH \$8H vlUH \$8H D$0H D$81 \$xH D$pH D$HH \$@H T$pH T$pH D$HH \$@L T$pH D$HH \$@L L$xH D$HM T$pH D$XL T$pH D$XH D$@1 T$pH D$PL T$pH D$PH 5.>. vaUH |$@H T$@H \$8H L$HH L$HH \$8H v-UH |$pH t$FH D$pH D$pH \$xH t$pH D$pH \$xH L$pH D$pH \$xH t$HL L$XH L$XH L$XH 5a_" \$`H \$`H L$XL L$PM d$PL d$XL \$HL t$`1 \$pH D$pH \$xH |$pH D$pH \$xH \$pH D$pH \$xH \$pH D$pH \$xH \$pH D$pH \$xH D$pH D$pH \$xH L$pH D$xH L$pH \$xH D$pH D$hH t$`H9 D$hH D$pH \$xH v%UH l$ M9,$u v$UH M9,$u \$ H \$(D |$@H D$HH L$@H \$PH D$(H t$0H D$8H D$ H L$@H t$HH D$PH T$ H T$ H \$81 D$@H \$hH L$@H L$hH T$pH D$HH L$HH L$pH \$01 D$`H L$HH L$HH D$pf L$`H L$XH L$XH T$`H t$PH T$xH T$xH t$PH L$XH D$ H L$ I T$`H L$(H |$@H T$8H L$@f L$(H t$HH T$`H L$(H L$`H |$(H \$(f T$0H T$0H L$`H \$(H |$HL |$XH |$XD |$pD L$pH T$XH T$xH D$pH \$81 D$XH L$`H D$HH D$HH \$PH D$XH L$`H D$HH D$HH \$PH |$XH L$XH T$`H L$HH D$HH \$PH \$PH D$HH t$@H T$hH T$hH t$@H L$HH D$HH \$PH D$HH \$PH vmUH D$PH T$PH D$8H L$ H T$PH T$ H T$PH \$(H L$0H T$(H L$0f T$8H \$HK D$XL D$XL \$HI L$XH T$PL T$hK T$PH T$XH |$HH) T$hM ~#L9 H@L) H(M) \$`H |$0H L$(L X L9 d$@O L$XL L$XL d$@I \$`L D$XL T$PL \$hK T$XH T$PH T$0H |$@H) L$`L L$(I) |$hI @8L9 P0L) |$XH L$PH \$hH t$8L L$PH \$hH t$8H |$XH p@H) T$0H \$`H |$(L T$0H |$(I \$`H L$0L D$(H D$`H D$`H \$(H L$0H |$8D |$@D |$PH D$xH D$@H T$xH D$8H T$xH D$8H T$xH B8H9 z0H) T$xH J8H9 L$@H D$PH9 T$8H t$HH) L$PH \$HH D$hH T$HH t$hH T$HH L$PH9 \$XH D$pH D$hH D$pH \$XL D$@H |$`1 T$@H T$`H D$pH D$pH L$hH \$HH |$`L T$xH t$@L L$hM d$PO T$xH \$HH t$@H |$`L T$hL d$PD L$HH \$@H T$PH \$@H L$HH9 T$PL L$HH \$@H D$xH T$`H T$PH9 D$XH \$pH L$HH \$@H D$xH T$`H \$pH \$@H L$HH9 D$PL T$`H =L~c \$ H \$ H D$PH D$,H \$PH \$8H D$0H D$H1 \$XH D$8H =r{c t$XI T$8H D$`H \$@H \$@H D$`H |$hD |$xH T$pH t$hH T$xH D$PH \$0H D$P1 \$0H D$PH D$PH \$01 =Uyc D$8H T$8H v[UH D$(H \$0H T$(H v[UH D$(H \$0H T$(H vdUH L$8H L$@H L$8H l$XM9,$u M9,$u v&UH M9,$u vRUH D$(H \$0H L$(H T$0H9J v^UH D$(H \$0H T$0H T$(H vAUH D$(1 L$ H L$ H D$(H v^UH D$(H \$0H T$0H T$(H v,UH L$ H =xVa |$8D |$HH \$@H D$8H T$HH D$0H D$(H D$0H \$ H |$hH |$pH L$hH T$pH L$xH D$`H \$HH \$HH D$`H \$XH T$XH L$XH \$PH \$PH T$XH \$PH T$XH L$PH T$PH T$XH D$@H \$XH \$XH |$XH |$XH L$XH \$PH T$PH T$XH =Sic T$pH D$hA 8amd6uqA 4ujL T$xA :linuuNA xuGL D$hH t$pf D$hH t$pf vpUH |$(H \$ H T$(H D$ H L$0H D$ H L$0I rmI9 D$(1 L$ H L$ H D$(f =Sdc D$01 L$(H T$'H L$(H BHH9 =abc ="bc Y8E1 '-L) IPE1 ,3M9 T$vE L$xH9 j0L9 \$`H \$hL d$@L \$hL d$@I \$`L =MZc xu*H \$`H L$HH L$XI L$XK t$PL t$PL \$`L =FXc L$ L L$ L D$ H9 |$ H |$ H D$HH9 T$0H T$(H T$'H L$0H T$'8 |$ H |$ H t$(f L$`H T$|f9 T$zf =QTc |$@D |$PH |$`H D$hH |$`H \$pH |$`H \$pL D$pH |$hH D$pH L$@H D$PH L$`H \$XH D$PH L$`H \$XH |$hL D$PH L$`H \$XH |$hL D$PH L$`H \$XH |$hL L$0H t$(L D$PH L$`H \$XH t$(H |$hL L$0A D$0L \$(H D$PH L$`H \$XH |$hL D$0A \$(M T$0H t$(L D$PH L$`H T$0H \$XH t$(H |$hH T$ H) L$0H L$0H9 T$8H9 L$0H L$0H T$ L D$@f \$Bf L$D@ |$Ff t$HL D$PL L$XM D$@H \$$H L$ f D$hf \$jf L$l@ |$nf t$pL D$xL \$8H D$H1 \$8H D$HH T$8H t$0H L$HH L$8H D$0H D$PH D$HL L$81 D$@H \$0H L$(H \$HH L$(H D$0H T$@H \$`H D$X1 D$(f \$*f L$,@ |$.f t$0L D$8L L$@H \$ H \$XL |$(D |$8H D$hf \$jf L$l@ |$nf t$pL D$xL L$L1 |$hD |$xL D$h1 D$hf \$jf L$l@ |$nf t$pL D$xL T$Lf9 t$0L D$8L L$@H |$(D |$8L D$(1 t$0L D$8L L$@H T$hD T$lD \$jD |$hD |$xL D$h1 D$hf \$jf L$l@ |$nf t$pL D$xL T$Lf9 |$(D |$8L D$(1 t$0L D$8L L$@H L$&D |$hD |$xL D$h1 D$hf \$jf L$l@ |$nf t$pL D$xL L$&f f9L$Lt5D |$(D |$8L D$(f L$,1 |$(D |$8L D$(1 |$(D |$8L T$(E \$,A D$ f \$"f L$$@ |$&f t$(L D$0L xu"L v^D8 D$hf \$jf L$l@ |$nf t$pL D$xL D$p1 T$xG xu"M T$PL D$@L D$@L T$PL \$HH T$pf D$Pf \$Rf L$T@ |$Vf t$XL D$`L T$hH9 D$`H) L$0H T$0H9 L$0H D$8H L$ L T$(L L$ L T$(L t$ L D$(L L$0L T$8L t$ L D$(L L$0L T$8L ut-w L$xL d$(H t$pM |$0I D$H1 D$'H |$hL d$`H D$8H \$XH T$PH T$PH \$XH t$pH |$hL L$xL d$`L l$(L D$'H D$@1 D$'H D$@D T$'E L$xL l$(H D$0H D$pH -u"H L$ L T$(L L$ L T$(L D$hfD |$(H t$8H t$@H t$(H t$HH t$8H L$ H L$ H \$(H T$PH \$(H L$0H D$(H T$PH \$(H L$0H \$(H L$0H vlUH D$(H =*-c D$HH L$XL D$pL9 |$`H T$`H \$XH D$0H9 L$0H L$(H |$ H t$(L D$0L |$ H t$(L D$0L v)UH D$(H }.s7H D$HH \$PH D$HH T$PH \$HH L$0H L$(H D$PH L$`H \$XH L$PH t$`H L$PH t$`H T$XH D8I T$PL D$X1 wHH9 L$PH t$`H L$PH t$`H T$XH D8I D8I L$8H L$0H tff=2 v}UH D$PH 89wOH L$`H D$PH \$XH D$PH L$`H vNUH D$HH D$PH L$`H \$XH L$PH t$`H L$PH t$`H T$XH D8I D8I !}gH D$8H9 L$8H L$0H D$XH 5EfZ D$@H L$@I D$(H |$0H L$0H D$8H \$(H RfA9 sif L$(H D$0H w5H9 |$(H D$8f \$:f L$<@ |$>f t$@L D$HL t$ L D$(L L$0A t$ L D$(L L$0A t$ L D$(L L$0E1 D$`H D$ L L$(E1 %E?Z %4?Z !sBH u fD D$ L L$(E1 D$@1 -@.Z !saL =-!Z !r M D$ L L$(E1 !sgO u fD u fD D$ L L$(E1 u fD tpf9 tkH=g !sWL b H+p8H x8H9 H@H9 H+P8H H+P8H T$ H JuJH H+Z8H B8H9 X8H9 P@H9 IuNH T$ H B@H9 p(H) 4;@85 \$(f ='qZ M9,$u D$ H \$ H \$ H D$ I D$HH \$hH \$hL L$8H \$Xf T$`H t$@H D$HH \$@H t$XH L$8H D$`L D$PH |$0H |$0L D$PH L$@1 vEUH L$PH \$HH D$@H \$HH vEUH \$`L D$@H t$8H |$0H t$8L D$@f |$ H t$(L |$ H t$(L \$xH D$pH T$HH T$@H T$XH \$p1 |$8H t$0L D$PH D$HH \$@H D$HH \$@H L$XH D$8H \$0H L$PH v+UH |$pH D$XH |$@H L$0H \$(H T$XH L$(H |$0H D$(H \$0H L$@f D$8H T$(H T$0H L$@I D$8H L$(H |$0H t$@f |$`H L$XH \$PH \$PH D$pH \$0H L$XH |$`H \$HH D$@H T$0H T$pL \$hH \$hH D$xH \$8H T$@H L$xH D$@H \$HH T$@H L$xH T$@H t$HH |$ H |$ H D$HH t$hH t$0H |$(H D$ H \$(H |$ H |$ H D$HH t$0H \$PH D$HH |$(H L$ H t$0H D$ H \$(H L$HH L$ H t$0H |$(H |$ H |$ H v1UH l$ M9,$u v5UH l$(M9,$u v>UH D$8H \$(H |$@H L$0H \$(H D$81 |$HD |$XD |$hH L$HH D$PH L$XH L$`H D$8H L$hH D$pH D$8H \$(1 L$0H |$@H t$8H T$@H t$8H D$HH T$0H L$(D |$PD |$`D |$pH L$PH D$XH L$`H L$hH D$0H L$pH D$xH L$HH vAUH L$PH \$HH D$(H \$HH D$(H |$ H |$ H t$(f D$xH D$xL =M!b T$pH T$hH \$@H |$@H D$`H D$XH T$@H t$XH T$@I t$XH |$`L D$PH \$PH \$PH \$PH L$PI D$HH \$HH \$HH \$HH \$HH \$HH D$HI L$ H L$ H T$(H L$0H T$(H T$8H v/UH l$ M9,$u D$xH D$XH D$7H D$8H D$6H \$XH \$XH L$HH D$xH D$`H \$@H T$PH t$HH |$xI L$HH L$hD D$h1 L$HH L$pD D$p1 t$PH D$`H \$@H t$PH L$@H9 \$PH T$(H L$(H t$Pf \$ H D$0H D$0H v,UH D$PH v,UH D$PH vYUH \$@H L$HH D$8H |$PH t$XL D$`H L$PH |$XH t$`H |$ H t$(L |$ H t$(L v"UH D$8f D$0H T$HH t$@L D$8L L$0L T$HI t$@I D$8M L$0M D$(H L$`H D$hH D$PH \$XH D$(H D$(H |$ H |$ H D$XH D$XH L$0H D$8H L$0H L$ H T$@H D$ H \$(H D$ H \$(H v0UH l$ M9,$u transactM9 check_inf D$0H L$0f check_inH check_inE1 D$8H D$8H transact T$PH T$XH T$pH T$PH T$x1 u&M9 check_inH97 T$@H T$HH T$pH T$@H T$x1 D$8I T$`H T$hH T$pH T$`H T$x1 |$ H |$ H v%UH D$@H v%UH D$@H v%UH D$@H D$xH \$8H T$xH T$8H \$pH \$pH t$hH L$81 T$0H L$8H t$hH9 T$0H t$XH t$(H L$HD D$XH D$H1 L$hH t$81 T$0H L$hH t$8f T$0H t$PH t$ H L$@D D$PH D$@1 D$`H D$`H |$ H |$ H v,UH D$PH v,UH D$PH D$PH D$8H T$PH T$(1 D$0I T$(L L$ H t$0H L$ H |$8H v,UH \$hH T$hH :http :http T$@H D$0H |$pH t$8L L$xH \$`H T$@f 9httpu6 9httpu T$@L D$PM :/u3H L$HH \$XH L$@H t$pH |$xL t$pI |$xI T$0H T$8H T$`H T$PH T$XH T$HH |$PD |$`H L$PH D$XH L$`H D$hH \$(H D$8D |$@H L$@H D$HH L$(H D$8H \$(D |$@H L$@H D$HH L$(H :httpu# :httpu \$0H D$pD |$@H L$@H D$HH L$0H \$(H D$8D |$@H L$@H D$HH L$(H |$8D |$HH D$xH L$8H D$@H L$HH D$PH T$xH :httpu" :httpu \$(H D$0D |$XH L$XH D$`H L$(H D$0H \$(D |$8D |$HH L$8H D$@H L$HH L$PH L$(H vTUH D$xH D$HH |$`H L$XH \$PH D$0H \$XH L$`H L$0H D$(H D$(H |$HH \$HH L$PH D$HH L$PH D$HH L$PI T$X1 |$X1 \$HH L$PH \$HH L$PH9 T$pH \$hH L$`H L$`H T$pH \$hH D$PH D$PH L$(H D$0H L$(H T$8H D$ H D$ H v0UH l$ M9,$u |$ H D$8H L$8H D$@I T$ H v%UH M9,$u D$PH D$PH \$(H D$0H \$(H T$8H D$ H D$ H v0UH l$ M9,$u v%UH v>UH D$XH \$`H T$XI T$`H D$@L T$`H D$@H D$0H \$8H D$0H \$8H T$HH T$PH T$(H T$HH T$01 v%UH D$@H D$XH \$HH L$pH L$HH t$pI D$hH t$HH D$X1 L$@H t$HH D$XL D$hH9 L$@M L$`M \$0L T$PD |$xD L$xH L$`H L$0H L$@H t$HL D$hL L$`I D$XL \$8K L$@H t$HL D$hL L$`L T$pL d$(I T$(H t$pI D$XH \$`H T$XI T$`H D$@L T$`H D$@H |$PD |$`D |$pH L$PH T$`H t$pH D$P1 D$(H D$(L L$@I |$ H L$@H \$HH \$HH \$HH ujHc \$HH \$8H \$8H 5s), \$0H \$0H \$0H \$0H \$0H \$0H \$0H \$0H \$0H \$0H D$XH \$`H T$XH T$XI T$`H D$@L T$`H D$@H l$xL \$pL \$pL l$xH L$hL L$xE1 T$pI L$hH L$xM9 T$pK v,UH D$PH D$hH D$PI L$HH t$@H \$PH T$`H D$hH \$@H L$HH \$@H D$XH D$XH \$`H T$XH T$XI T$`H D$@L T$`H D$@H L$hH |$x1 D$pH L$hH |$xH9 D$pH v,UH D$PH D$XH L$XH T$XI T$`H D$@L T$`H D$@H D$`L D$`M t$ H T$pI T$`H T$pH D$HL D$HM t$ H T$pI T$HH T$pH \$PH L$XL L$XH \$PL |$`H \$@H \$pH L$hH L$hH \$pH T$HH L$`H \$@H9 T$HH \$xH \$xH \$xH \$xH \$xH D$pH \$xH \$8H L$@H D$Pf L$@H D$PH \$8H D$HH D$xH D$XH D$HH L$pH |$XH D$HH \$0H D$xH L$pH |$PH T$PH T$XH t$@H T$HH T$@H L$HI |$`H L$XH |$8H T$hH t$HH T$(H L$XH T$(H L$HI |$`H T$`H L$PH |$0H T$hH t$@H T$ H L$PH T$ H L$@I D$pH \$HH \$HH D$pH \$0H D$PH D$Pf L$8H T$`H L$8H T$`H D$P@ t$@H t$hH \$XH T$@H T$hI D$XH |$ H 8httpu* D$xH \$XH |$HH t$pH t$(H T$0H D$pH \$(H L$0H \$hH T$hH L$XH t$hH T$hH L$8H L$xI L$XH T$PH \$hH T$hH |$@H \$`H L$`H T$@H L$XH t$PH T$PH9 L$xH \$XH L$XH \$pH T$xH \$hH D$XH L$pH L$hH t$XH T$pH T$XH T$pH t$XH D$XH L$pH d$8A T$@L |$hL L$`H L$pH T$@H |$hL L$`L L$p1 L$pH T$HH L$HH t$hH L$HH t$hH vuUH transactH9 check_inf D$ H \$(H L$0H |$ D |$0D |$@H D$`H D$8H \$@H L$HH D$`H D$ H \$(H L$0H T$ H L$(H T$0H D$@H L$HH T$PH L$XH T$`H \$pH L$pH D$hH T$HH t$PH |$XH T$HH T$PH L$`H L$hH T$`H H9Y ~RH T$pH v%UH M9,$u T$hH |$`L T$hH |$`L T$hL L$`L T$`H T$hH T$hH |$`L T$hH |$`L T$hL L$`L T$`H T$hH |$XL t$XL T$hH |$`L T$`L T$hI |$h1 D$`I |$hH D$`H |$PH D$xH D$xH t$0H T$0H 9tracuN eu>H transactM9 u2fA iou)A |$HH D$pH L$pI t$@H T$@H t$8H T$8H D$xH v,UH D$PH v0UH l$ M9,$u v|UH v%UH |$hH |$`H |$HH D$`H \$hH L$pH \$PH L$XH D$xH T$PH \$XL \$xI t$PI rxI9 wkM) D$`H L$hH \$pH |$HH D$`H \$hH L$pH D$`H \$hH L$pH |$HH |$ H |$ H v/UH l$ M9,$u D$0H \$ H L$(H L$0I L$ H L$(H \$HH D$@H D$(H L$ H L$(I L$ H D$XH \$`H T$XH \$@H T$8L T$0H D$8H \$@H L$0H D$8H \$@H L$0H L$hH T$pH t$xH L$HH D$PH L$HH =&V! L$`H L$PI L$`L t$HL D$@H |$xH T$PH T$@H L$HH9 D$XH D$xH D$XH L$pD L$HH T$@H t$hH L$pH t$hH T$@H L$HH9 D$XH D$xH D$XH L$HH T$@H |$`H D$pH \$xH L$PH L$PH L$PH T$HH t$0H T$HH T$HH D$PL L$8u L$8H T$HH D$PI w#H D$8H L$0H9 D$XH D$0H D$`H D$XH \$`H L$hH L$@H D$XH \$`H L$hH L$8H D$HL D$8L D$@H =B{a L$xH D$gH \$xH D$gH \$xH D$gH \$xL =Hxa D$pL D$hL D$pH \$xL D$hL ?runtu et)H ?testu D$0H H9HH|!H D$0H T$0H =Iqa L$pH |$xH \$`H D$hH L$`H9 r2H) L$hH \$`H D$hH \$@H L$@H9 D$ H t$8H t$ H T$@H9 D$8H =[na =)na D$xH \$@H T$xH t$`H T$8H T$8L T$8L D$`L L$xI T$XI T$0H \$@H T$0L T$0L D$XL L$xI T$xH t$PH T$(H T$(L T$(L D$PL L$xI T$xH t$HH T$ H D$ H D$ H L$HH T$xH =Dja D$HH D$ H T$(H L$0H s<@ sUH =udY v UH D$PH \$0H D$8H D$(H T$PH L$(H9 T$0H9 T$PL :wsu[ suU1 \$8H L$0H :httpu% \$8H L$0H \$8H L$0H L$0H L$8H =6|[ =l{[ =rw[ =av[ 9Hostu;M 9Upgru ConnectiL9 ConnectiH Connecti =Nr[ =hq[ =yp[ 8http =Po[ 8http =vn[ =Hm[ ;http =Ti[ =5a[ =B_[ =]^[ =V][ http/1.1H90t |$ H t$(L |$ H t$(L v$UH D$hH L$xH L$8L L$0L L$PH \$HH D$(H \$8H L$0H D$ H \$@H L$(H L$ H |$@H D$(H \$H1 v>UH D$HH L$XL vCUH D$@H L$PL vCUH D$@H L$PL vCUH D$@H L$PL \$0H D$HH L$@H L$PH L$XH L$`H D$hH D$8H T$8I T$@H T$HH L$0I D$PH \$XH L$`H \$XH D$PH L$PH L$`H =tT[ \$XI T$0H D$(H \$8H D$ H L$(H \$8H L$8H L$8I T$(I L$0H \$pH D$hH L$xH \$pH t$ H D$hH L$xH \$pH t$ H L$@H T$8L D$PH t$ H \$HH D$(H L$(H D$hJ T$0H D$HL L$(H T$0L D$hH D$@H ryH) |$8I \$PH L$@H \$PH |$8L D$hL L$@I T$ H T$ H v;UH \$8H \$ H L$8H L$8H \$ H \$PH D$HH D$ H \$(H L$0H D$ H L$0H D$ H L$0H \$(H D$8H \$ H L$8H T$8H \$ H D$xH websockeH T$/H ebsocketH T$0H : close H T$8H T$xL \$@H C L9 T$xI \$@I (normalL T$xI \$@I (going L ng away)L \$@H L$HL D$@H D$XH T$xH L$HL D$@H \$@L D$@H D$XH L$HH T$xH L$HL D$@H T$xI \$@I (no staL tus)f \$@L D$@H D$XH L$HH T$xH L$HL D$@H \$@H L$HL D$@H D$XH T$xH L$HL D$@H \$@H L$HL D$@H D$XH T$xH L$HL D$@H \$@H D$XH L$HL D$@H T$xH L$HL D$@H \$@H L$HL D$@H D$XH T$xH L$HL D$@H \$@H L$HL D$@H D$XH T$xH L$HL D$@H \$@H L$HL D$@H D$XH T$xH L$HL D$@H T$xL D$PfB |$PH T$`H \$@L T$`H |$PI \$@L D$@H D$XH D$@H D$XH \$PH D$0H L$HH L$0H \$ H D$(H L$0H L$ H L$(I L$HH T$`H T$8H |$8I t$XH |$0L \$(H D$HH L$`H L$`I \$HI L$(H L$0H L$XH L$XI D$PH L$8H L$PI L$PI =~C[ D$Xu D$@H L$ H |$hH |$pH D$hH L$ H L$pH L$xH L$XH =}B[ \$@H T$hH |$@H t$pH D$ H L$0H |$8H t$@L D$HL L$PL D$ H L$0H |$8H t$@L D$HL L$PL D$hH \$pH T$hH |$pI D$@H \$HH9 D$@H \$HH L$@H \$HH L$@H vpUH T$X1 D$PH \$@H |$@H t$HI \$@H L$HH D$8H \$ H L$8H L$8H \$ H \$ H D$PH D$0H L$ H9= t$8H |$(H |$(H t$8H t$8H |$(H L$PH D$0H L$ H |$(H t$8H |$8H t$pH L$0L |$@H L$xH T$xH T$PH T$PH t$(L D$XH t$(L D$XH \$0H L$8H D$hH ==:[ T$hI t$@L D$@H \$HH \$HH D$@H D$@H D$@H \$HH L$`H L$`H D$@H \$HH D$ H \$(H L$0H |$8H t$@L D$HL L$PL D$ H \$(H L$0H |$8H t$@L D$HL L$PL v%UH L$hL D$`H |$6H D$2H \$XH \$HH D$PH L$Hf |$PH D$PH T$HH \$`H L$hH D$PH T$HH D$`H \$hH \$81 t$@L t$@L \$`H L$hH L$HH \$@H \$@H \$pH D$pH \$xH D$pH D$pH \$xH t$pL D$pH \$xH L$pH \$xH D$pH L$pH \$xH D$pH D$pH \$xH D$pH \$xH D$pH \$xH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L v%UH D$@H \$HH L$PH L$@H L$PH \$HH T$ H L$PH T$ H \$HH t$@H |$(H L$PH \$HH t$@H |$(H |$@H T$@H T$@H =k/[ D$0H \$8H L$8H D$0I L$8I t$0H =!.[ \$PH L$XH =k-[ =F-[ \$PH L$XH T$ H \$(H L$0H L$XH \$PH M8M9 M@L) U@M) E0fA U8M9 W D l$hA D$\H D$hH \$\H9 D$hH t$\L l$hL |$`A |$ H |$ H vlUH R8H+P D$8H \$@1 t$8H W8H+V \$@H9 \$`H L$hH D$h1 D$XH T$hH |$8H L$0H \$@H t$XH T$8H9 wdH9 D$(H D$(H T$8H \$@H t$XH L$0H9 \$HH D$@H L$PH T$PH L$ H \$(H t$@H T$ H9 wUH9 T$ H \$(H \$`H L$hH D$XH \$`H L$h1 L$hH \$`H T$8L M9A8u41 D$XH L$hH T$8H \$`H ~@L) T$XH t$8H t$0H \$(H L$@H t$01 t$0H \$(H t$8H v5UH |$@D |$PD |$`H D$PH9 R@H) L$0H L$PH \$8H D$(H L$(H |$ H |$ H v6UH |$(H D$GD L$FE @tuH D$GD tsL D$GD T$FI D$GD T$FI d$EM T$FD d$EI T$FD d$EI T$FD \$GI T$FI T$FH T$FI t$F@ t$F@ L$pH \$hH L$pH \$hL T$pH \$hH L$xH D$xH T$pH L$hH \$xH D$HH tTI \$@H D$hH T$XH D$hH L$@H |$PH t$@I \$HH D$`H L$HH L$`I D$8H D$8H D$8H D$8M L$8H L$ H L$ H L$8H \$ H \$ L D$8H \$`H D$XH T$8H |$pH L$hH D$XH L$hH \$`H |$pH T$8H L$8H D$(H T$8H L$(H |$pH9 T$8H D$(H) H95i 5-vW \$@H t$0H T$8H \$@H v"UH |$HH \$@H= D$8H L$HH \$@H L$HH t$8f \$@H9 D$ H D$ H \$8H |<(1 |<(1 v-UH \$8H |$HL |$ H |$ H D$8H \$`H T$`H T$xH L$xH D$XH L$xH L$XH L$xH L$hH L$hH D$xH \$pH L$xH L$pH |$ H t$(f |$ H t$(f v{UH D$(H \$0H L$8H |$@H |$@H |$HH #EgH T$DH T$LD D$@1 D$0H D$XH r H) t$0H D$@H L$(H \$`H T$(H \$@H9 D$8H t$ H D$8H T$(H \$@H t$ L D$(H |$`H T$(H) T$@H D$XH |$0H L$@H \$(H L$(f \$ H D$@H L$(H T$ H) L$8H T$0H9 w}H) T$@H \$XH t$pH |$hH t$(H T$8L \$0O T$8H t$(1 L$ I \$0M L$hH t$ H T$8H t$(L |$ H |$ H t$xH t$xM D$hL L$pL L$PH L$hH L$PI L$XL9 \$pL L$H1 \$@H T$HL T$@H t$xL D$XH L$PH t$xL t$xL D$XH L$PH t$xL D$XH L$PH D$`H) r0H) |$XH T$XL D$PH T$hL D$`H 8sock T$@H L$0H L$HH L$0H T$HH T$HI T$@H \$(H D$8H T$(H T$8I \$pH pt(f ;tcp4t ;tcp6 D$hH \$PH D$8H \$HH D$0H L$8H L$0H |$HH D$8H \$P1 \$(H D$@H T$(H T$@I |$ H |$ H t$(f \$xH L$xH \$pH L$pH \$hH L$hH |$ H |$ H L$8H D$(H \$0H L$(I L$0H T$8H T$8I H9S( S8H9P8 D$(H \$0H T$0H T$(H T$0H T$(H T$0H T$(H T$(H t$0H9F@t vYUH P H9S t v=UH v7UH vWUH D$(H \$0H L$(H \$0H9S vAUH \$8H |$HH |$ H |$ H t$(f l$0M9,$u v?UH D$8H L$HL l$8M9,$u L$pH L$xH T$pH D$XH L$PH L$HH T$XH |$PH t$HL T$XL D$@H \$6H \$6H D$@H \$6H D$PH \$HH L$hH L$@H T$PH T$HH T$hI D$`H T$`I D$@H \$6H \$6H |$ H t$(L D$0D |$ H t$(L D$0D v%UH M9,$u v5UH \$?H |$ H t$(L D$0D L$8f |$ H t$(L D$0D D$XH D$(H D$(H t$XH D$@H L$@H L$@I T$(H \$(H D$8H L$(D D$ H D$0H L$ H T$0H L$ I T$0I t$(H L$(H L$(H \$(H vuUH D$XH D$@H L$@I D$8H \$ H L$(H L$8H \$8H L$ H T$(I \$ H \$8H D$0H L$XH L$XH T$8H L$XI T$8I \$0I \$8H D$hH T$PH T$hL \$HH T$P@ L$/L D$`H t$0H L$HL \$@H D$Hf T$xH D$xH L$xH L$/H \$0H T$hH \$HH D$8H \$pH D$XH \$8H L$pH |$hH L$PH L$PH L$HH D$XH t$8H T$HH D$xH \$xH t$8H t$8H t$Xf t$XI D$pH \$HH D$hH D$pH \$hH D$@H \$`H D$PH \$@H L$`H D$xH D$8H L$8H L$8I T$xI D$@H |$HD |$XH T$8H T$XH L$HH D$HH \$01 L$@H D$XH T$@H \$PH D$xH \$xH L$XH D$pH L$pI D$hH L$XH L$`H T$hI L$@Hi T$`H \$81 D$hH \$HH v/UH v%UH M9,$u L$0H L$@H \$(H9 L$@H u0H9 L$@H L$`H D$hH D$XH \$0H D$PH D$XH \$PH D$HH D$8H L$8H T$HH L$8I T$HI T$HH |$`f L$`H D$hH D$XH \$0H D$PH D$XH \$PH L$XH L$@H L$`H L$8H L$(H D$@1 T$XH \$0H D$HH L$PH \$0H t$PI 5p"W T$0H \$0H t$PI T$0H D$Ht L$'H L$'H L$'H L$`H L$`I T$HI T$`H L$hH L$hH T$`H L$hI T$`I \$8I L$(H v0UH l$0M9,$u v%UH l$ M9,$u \$HH D$>H D$PH \$XH D$@H T$@H T$XI T$pH L$pH L$pI D$hH D$`H T$`H \$hH T$`I \$hI D$`L \$PH \$PI D$>H D$>H |$ H |$ H t$(f T$pL \$XH T$pL \$XL \$81 T$hH L$HH |$HH D$hM D$pH \$HH L$pH T$PH L$XL L$xL D$xH \$01 T$`H L$@H D$`M D$pH \$@H L$XA T$hL \$HL T$PL L$XL |$xD L$xH D$xH \$81 D$hH D$HH D$PH D$HH D$`H L$pH D$HH D$`H D$hH v'UH l$ M9,$u v(UH l$ f M9,$u v(UH l$(f M9,$u v/UH l$ M9,$u D$@H L$@H T$ 1 L$@H T$ H L$@H L$@H D$(H L$@H L$@I T$(I D$(H D$ f L$ H L$(H L$(H |$@H L$@H \$HH D$@H D$pH t$`H D$pH9 L$XL T$hI) =z}Z T$@H \$HH D$@H =w{Z D$PH T$PH \$81 L$@H D$@H \$HH T$@H \$HH D$@H T$@H \$HH D$@H D$@H \$HH |$ @ t$!L D$(L t$!L D$(L v@UH l$ M9,$u D$HH D$0H \$(H \$(H D$0H T$HH \$&H |$&f L$HH D$xH L$xH T$xH T$8H L$pH D$hH T$pH L$hM \$BE =fpZ T$Bf =HoZ T$hH \$:1 T$hH \$X1 D$7H =tkZ |$Bf =ojZ T$Bf T$VH =fiZ \$L1 =3gZ L$hH \$`1 L$hM T$hH \$D1 =:bZ L$9H L$9H L$9H L$9H L$9H L$9H D$8H L$ H =1]Z L$8H T$ H L$8I T$ I v{UH \$8H |$@D |$PH L$`H L$PH D$@H D$@H \$01 v%UH v}UH \$`H |$@D |$PH L$`H L$PH D$@H D$@H \$01 T$8H L$XH |$`H D$0H \$ H D$(H D$0H \$(H vgUH T$HH D$ H \$(H L$0H vYUH \$ H L$(H v7UH \$8H L$@H v7UH \$8H L$@H |$8H L$(H L$PH L$0H T$(H T$8H v%UH M9,$u |$8H D$PH t$pH |$hH L$`H L$(H L$PH L$0H T$(H L$XH |$`f T$hH L$pI T$8H T$8H |$ H |$ H v%UH M9,$u |$`H D$xH D$xH T$PH D$XH T$PH D$&H L$xH L$(H T$@H D$HH \$HH =ZSZ D$HH \$HH D$(H D$0H D$@H T$`H D$0H \$8H T$`H \$8H D$0H D$0H \$8H v0UH l$ M9,$u D$`H \$hH L$pH L$xH D$PH L$xH T$HL D$XH D$XH \$HH D$PH L$`H T$hH D$`H \$hH L$pH D$`H \$hH L$pH v0UH l$ M9,$u |$@H D$XH L$hH L$(H L$XH L$0H T$(H D$`H D$&H L$XH L$`H T$XH L$`H D$8H \$8H D$8H \$8H T$@H T$@H v%UH M9,$u |$8H L$(H L$PH L$0H T$(H T$8H T$8H v%UH M9,$u |$8H L$(H L$PH L$0H T$(H L$PH T$8H v%UH M9,$u D$0H =]FZ =,FZ |$8H t$0I =NEZ t$0H |$8H T$@L D$(E uWH T$(H D$0L T$(H D$0L T$(H D$0L |$@H T$@H D$HM L$0E T$,M D$8A uvL T$0H T$,f T$.H T$0H T$,f T$.H vEUH D$(f L$(H D$(f |$0H D$HH \$PH L$ H L$HH L$(H T$ H T$HH T$HH T$PH L$XI T$HH T$PH L$XI D$`H L$Hf9A s T$0H v%UH M9,$u |$8H D$PH L$`H L$(H L$PH L$0H T$(H t$$f t$&H t$$H |$Pf9w u t$$H |$Pf T$8H D$"H T$$f T$&H T$PH T$XH =dH 5o~$ |$HH D$@H |$@H D$PH D$hH 5 z$ |$hH D$PH T$PH D$XH |$XH D$`H |$`H \$`H T$`H L$`H D$pH |$pH \$pH L$pH D$xH 5Us$ |$xH \$xH L$xH D$xH D$XH D$8H D$PH D$@H D$HH L$XH T$HH \$8H t$@H L$XI T$HI \$8I t$@I |$`I L$PH T$HH L$PI T$HI \$`I L$`H L$`I T$HI D$@H \$HH |$ H t$(L D$0L |$ H t$(L D$0L L$ H t$@H L$ H T$(D |$ H L$0H T$8H D$@H L$ H t$(H |$0L D$8H |$HH D$8H L$@H T$PH t$XH |$HH |$HH t$`H D$(H T$hH D$ H L$pH |$xH D$0H \$pf ulfA :tcu :tlf :ssu |$XH :mqtt :tcps :unix :mqtt mqtt+sslI9 L$HH \$PH D$@H L$HH L$@H |$PH |$ H t$(L |$ H t$(L L$@H \$XH \$@H |$XH D$xH D$hL D$hH \$HH L$`H D$pH D$xH \$pH T$HH T$HH T$`I L$HH T$@H \$81 D$xH D$pH t$hH t$`H T$XH D$pH \$xH D$hH \$`H \$HH D$@H D$PH \$HH D$@H v'UH M9,$u v'UH l$ M9,$u D$@H 9+tg D$hH t$`H |$XH L$PH \$HH D$@H L$PH \$HH t$`H |$XL |$ H t$(L |$ H t$(L vuUH D$XH |$pH D$@H \$8H L$0H D$hH \$pH D$@H \$8H D$@H D$@H \$HH |$ H D$8H L$8H D$@I T$ H v%UH M9,$u D$PH L$`H |$hH D$8H D$ H D$0H D$(H L$(H T$ H t$0H L$(I T$ I t$0I T$(H T$(H L$XH T$PH \$(H t$hH |$8L D$ L T$0L L$XI T$PI \$(I t$hI |$8I D$ M T$0M D$ H |$GL d$xL L$PH L$PH A fD T$GI T$GE T$GI T$GL \$XH T$GL \$XH \$XH T$GL \$X1 t$XM T$FM d$HL |$pI d$HL |$pI D$GE T$XI L$`f D$GL D$GL L$`L T$XH D$GL T$FL T$XH L$`H L$hH T$GL \$Xf L$hH v/UH L$ H \$8H |$0H L$(H D$ H D$0H D$(H L$ H \$8H |$0H L$(H D$ H D$0H D$(H L$0H \$HH L$Hf L$HI D$@H D$8H t$ H \$HH D$ H \$(H L$HI D$@H D$8H L$PL T$@L \$`L d$HH D$PH T$XL T$@H |$hD |$xH T$xH T$hH D$hH \$01 T$XH T$HH \$81 D$HH D$HH L$ H D$(H L$ H T$0H v0UH l$ M9,$u D$HH D$HH L$ H D$(H L$ H T$0H v0UH l$ M9,$u |$@H L$0H L$XH L$8H T$0H T$@H D$(H L$ H L$XH L$XI D$(D T$@H D$(H L$ H T$@H D$(H L$ H D$(H L$ H v%UH M9,$u |$0H L$ H L$HH L$(H T$ H T$0H T$0H vUUH D$ 1 L$8H T$8I |$ H L$8H D$8H T$ H v%UH M9,$u |$HH L$8H D$`H D$@H L$8H D$01 T$HH D$(H L$ H L$`H L$`I D$(D T$HH D$(H L$ H T$HH D$(H L$ H T$HH D$(H L$ H D$(H L$ H L$8H L$0H L$@H T$8H L$0I D$(D T$HH D$(H L$ H D$0H D$`f T$HH D$(H L$ H T$HH D$(H L$ H D$(H L$ H v%UH M9,$u v%UH M9,$u v`UH D$0H |$pH L$hH \$`H D$XH |$(D |$8H L$(H L$8H D$@H L$XH D$`H |$(D |$8H L$(H L$8H D$@H L$XH |$hH t$pH D$`I L$hH |$(D |$8H L$(H L$8H D$@H L$XH |$hH t$pH D$`I |$ f |$pH L$hH \$`H D$XH |$(D |$8H L$(H L$8H D$@H L$XH D$`H L$hf |$(D |$8H L$(H L$8H D$@H L$XH |$hH t$pH D$`I L$hH |$(D |$8H L$(H L$8H D$@H L$XH |$hH t$pH D$`I |$ f D$pH D$8H L$pH |$@D |$PH L$PH T$@H D$@H \$01 L$8H v2UH D$ H L$ H D$XH D$XH L$0H D$8H L$0H L$ H T$@H D$ H \$(H D$ H \$(H v0UH l$ M9,$u D$ H \$(H L$(H T$ H L$0I L$ H D$xH |$@I L$xH D$`H L$@H L$`H T$xL L$0H \$XD L$XH D$pH \$8H D$hH D$pH \$hH L$0H |$H1 D$PH T$PI L$0H |$HH |$ H t$(L |$ H t$(L |$`H D$HH |$0H L$(H \$ H L$HH T$ H T$(H T$0I |$`H |$8H T$HH T$HH D$PL D$XL D$PL D$8H T$`H D$0H \$8H L$@H D$0D T$`H D$0H \$8H L$@H D$0H \$8H L$@H v/UH l$ M9,$u |$hH |$@H t$XH t$`H t$XH D$0H L$PH \$8H D$0M D$(D T$hH D$(H \$@H L$HH D$0H L$PH \$8H D$(H \$@H T$hH D$(H \$@H L$HH |$@H T$hH D$(H \$@H L$HH D$(H \$@H L$HH v/UH l$ M9,$u D$(H \$0H \$09S Q 9S u I$9K$ vGUH D$ H \$(8S0u I18K1 viUH P H9S t v?UH D$ H T$(f9J0 v?UH D$ H T$(f9J0 H H9K v]UH D$(H \$0H T$(H t$0H9F M9,$u M9,$u M9,$ M9,$u v9UH D$ H L$ H l$ M9,$u M9,$u v9UH D$ H L$ H l$ M9,$u M9,$u v9UH D$ H L$ H l$ M9,$u M9,$u v9UH D$ H L$ H l$ M9,$u M9,$u v9UH D$ H L$ H l$ M9,$u vNUH \$ H t$4D D$8D L$X \$PH \$PL |$@H |$@L \$pH L$xH \$pH L$xH9 |$@H L$pH T$xH =?9X D$p1 D$`L L$hI L$hH L$hH |$hH L$hH \$`H |$ H t$(L D$0L |$ H t$(L D$0L v{UH T$8H L$HH L$HH T$8H =73X |$(L D$@H D$XH T$8H T$ H T$0H T$XH L$8H t$0H9 D$@H \$(H L$8H =#1X \$eD D$fH L$xH L$hH runtime.L9 goexu T$eE runtime. runtime.L9 runtime.E1 L$hH T$pD T$eI runtime. T$eI runtime.1 \$gH D$pH \$hf D$xH+ \$gD T$eI runtime.D D$fI runtime. |$ H t$(D |$ H t$(D v%UH D$8H \$@1 v)UH D$8H \$@H |$PH D$PL D$PL D$`L D$`L D$XL D$XL D$hL D$hH L$PH H+L$XH L$HH D$`H+D$h L$HH9 \$@D |$ H |$ H v0UH D$@H \$HH vEUH D$@H \$HH \$HH D$@H L$ H L$ H D$(H L$ H L$ H9 T$@H \$(H L$xL D$hH \$pH L$8H D$PH \$8H D$HH \$8H D$PI T$8f D$@H L$@H L$8H T$PL T$PI T$HM \$pH L$xH |$ H t$(L |$ H t$(L H H9 |$PH \$pH L$hH \$pH T$@H T$HH T$@H L$hH L$hH L$pI T$PH D$0H \$8H D$0H T$PL D$0H \$8H D$0H \$8H v%UH l$ M9,$u v/UH l$ M9,$u D$hH D$P1 L$@H L$?M L$@H D$@H L$ H T$(H T$(H v/UH l$ M9,$u v0UH D$@H \$HH v0UH D$@H \$HH L$HH \$HH T$Hf D$XL 9muteug xuaH L$pH \$h1 T$XL |$PH t$pA T$`H L$pH \$hH t$XH9 T$`H L$xD L$xH L$xH \$hH D$P1 L$xH L$xH D$PH |$ H t$(L |$ H t$(L |$8H D$XH vXUH D$0H T$0H T$hH \$`H \$`L T$`H T$PL T$HL T$HL \$`H \$`L T$`H T$XL T$XI T$@f T$@I T$@H |$ H t$(L |$ H t$(L \$PH D$HL L$xL D$pH t$hH T$0H D$(H L$hH |$pH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L T$pH \$hH \$hL T$hH T$`L \$hH \$hL T$hH T$XL T$XI T$HH T$HI T$HI T$@H T$@I T$@H T$PH T$PL T$PL |$ H t$(L D$0L |$ H t$(L D$0L D$hH \$pH L$xL T$hH L$xH T$PH D$hH \$pL L$HH T$hH L$HH T$PH D$hH T$hH L$HH T$PH D$hH \$pL T$hH T$PH D$hH \$pL |$@H T$hH T$PH |$@I D$hH T$hH |$@I T$PH \$pL L$hH L$hH L$hH |$`L |$`L t$XL t$XL T$pL T$xL T$xI T$@H T$@I T$@I T$Hf T$HL T$HL D$Pf D$PL D$PL \$ H L$(H |$0H t$8L D$@L L$HL T$PD \$ H L$(H |$0H t$8L D$@L L$HL T$PD runtime.H92u. goexu%f runtime.H L$fu runtime.L9 goexu L$pH \$hH D$gH \$hH L$pH9 D$gLk D$xH D$gH |$fH \$hH D$(H L$HH \$ H T$`H L$hH T$0H L$hI T$0I \$HI D$8H L$(H L$ H L$8H D$@H D$@H D$@I L$8H L$8H L$8H D$8H l$(I T$(H D$HI D$hH T$8L L$XL T$@L \$`L d$0I \$@L L$8H D$HL \$@I L$8I d$`H) L$0H L$XM |$ H t$(L D$0L |$ H t$(L D$0L M^M9 l$`H L$ H d$_H D$_M T$0L T$0L T$hI T$hI D$pH= D$pH l$xI l$xH viUH D$@I T$8L \$HI \$HI T$8H D$@H L$xD D$`H D$`H D$XH D$XH L$pH \$h@ |$GH D$PH D$PH \$xH |$hH t$pD D$HH D$HH |$ H t$(L D$0L |$ H t$(L D$0L L$PH |$XH \$HH L$HH9 T$HL T$HH L$HL \$@I T$@L T$HI |$ H t$(D |$ H t$(D $2M9 d29E T$XL D$HH T$XH T$XL T$PH T$PL T$PL T$`H T$`L T$`L T$hH T$hL T$hL D$pf D$pI D$pI T$xH T$xH T$xH d$0H D$HH M9,$u =azT 5bzT D$XH D$8H D$xH :0u H L$xA |$XD |$hD |$xD T$@H D$PH \$HH D$PH T$@H \$HH D$@L \$HL D$@L \$HH D$@L D$@I D$@L T$xL T$xH L$`I L$xH L$hH \$XH L$xL L$hI L$xL L$hI \$XL L$PI L$xH T$hL L$PI L$xH T$hL L$PI t$pI L$xH T$hH t$pL t$pL L$`f T$xH L$`I |$ H t$(f |$ H t$(f \$HL D$@L \$HH D$@I D$@L T$xL T$xH L$`I L$xH L$hH \$XH L$xL L$hI L$xL L$hI \$XL L$PI L$xH T$hL L$PI L$xH T$hL L$PI t$pI L$xH T$hH t$pL t$pL L$`f T$xH L$`I |$ H t$(f |$ H t$(f |$hH |$hH D$PL |$hL D$PL L$pI \$HL |$hL D$@L L$pI \$PL T$`L L$pL T$`I \$PL d$xL \$`L D$XK T$`H T$XH T$xI \$HH |$hL D$PL L$pI D$@I |$hL D$@L L$pI |$ H |$ H \$@H T$`H D$`H T$`H D$`H \$@H T$`H \$Hf T$`H D$`H T$`H D$`H \$HH T$`H D$`H D$PH D$PL L$`I D$PL L$`I \$HL D$@I T$PL D$@L L$`I T$PL D$@L L$`I \$hL) t$XM T$PH \$hH t$XL T$`H \$hH t$XL w&H9 =`|W T$xL =l{W T$xI D$hL D$hL L$hH D$PI D$PL \$XL d$`H \$p1 \$pH D$PL \$XL d$`L9 runtime.H9 runtime.E1 runtime. d$`M) \$XM) \$pH T$@H T$@I =%vW T$@I L$Hf =euW L$HH L$HH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L v6UH D$0H \$8H L$@H |$HH t$PH D$@H \$HH L$PH |$XH t$`L D$hL L$pH L$@H+L$HH H+T$ v%UH |$ H t$(L |$ H t$(L d$pD \$WE d$VE \$WD d$VH \$WD L$Vf \$VH d$pI D$xH t$hH \$xL9 T$XH \$XL9 =(jW D$`H \$WE |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L \$pO =ifW L$hL L$hL \$pL L$XM9 L$XL \$pL D$Pf L$XL \$pL T$xH D$hH |$`H D$hH T$xH |$`L D$PL L$XL \$pL T$hH T$hH D$PL \$pL |$xH t$hL |$`H \$xH t$hL D$PL L$XL \$pL L$Xf L$XL \$pL L$XL \$pL T$hH T$hH D$PL \$pL |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L \$pO L$hL L$hL \$pL |$xH t$hL |$`H \$xH t$hL D$PL L$XL \$pL L$XM9 L$XL \$pL L$XL \$pL |$ H t$(L D$0L L$8L T$@f |$ H t$(L D$0L L$8L =xTW T$xL d$pH D$`H |$hL T$xL d$pL T$hM9 D$`H T$hD T$PI D$`L |$hI T$PO D$xN D$xL = PW D$xL D$`H |$hL D$XI D$`H |$hL D$XO D$xN D$xL D$xL D$`H |$hL |$ H t$(L D$0L |$ H t$(L D$0L |$XL T$PH d$xN d$pN d$hH T$HM D$`H D$XL L$xL T$HL D$XH t$pL D$PL L$hL T$HL D$`L |$XI L$HH |$ H t$(L D$0L |$ H t$(L D$0L L$hN D$pN D$hM D$`H L$PL L$hO D$pO D$hH D$PH D$XO L$hO D$pO D$hH D$XH |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L D$(H D$ L d$`N D$hA D$xA \$ M \$ I9 d$`N D$hN D$xN =dDW L$@H |$0L \$8H L$XL d$PH \$XH T$(H |$0L D$HL L$@L \$8L |$ H t$(L D$0L |$ H t$(L D$0L D$PI T$`I T$HH T$HH D$PL \$`H l$xL \$@I l$xN \$@H =|AW l$pL D$hL d$`H T$XH \$hH T$XH \$@L d$`L |$ H t$(L D$0L |$ H t$(L D$0L l$xA t$pL ,qH9 \$XL d$pH t$PN t$PL t$PL \$XJ \$pL d$hL D$`N D$xA D$`L T$hO D$`L T$hL |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L v^UH D$(H \$0H T$0H T$(H \$wE d$vE \$wD d$vH D$(A \$wD \$vH T$xH \$xL9 D$(L =c3W \$wE |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L =G/W D$(L D$xH T$pH T$pH9 D$(L D$xH T$pH D$xH T$pH =a)W T$pH =h'W T$xL T$xM9 D$(A |$pD |$pM9 D$(A |$pD |$pJ |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$xH T$pH D$xH9 D$(L D$xH T$pH T$pH9 D$(L D$xH T$pH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L d$(A D$(L \$pI \$pMk D$(L d$xI d$xMk D$(L |$ H t$(L D$0L |$ H t$(L D$0L |$XL T$PH d$xN d$pN d$hH T$HM D$`H D$XL L$xL T$HL D$XH t$pL D$PL L$hL T$HL D$`L |$XI L$HH |$ H t$(L D$0L |$ H t$(L D$0L d$(A D$(L L$pLk D$(A D$pH D$xMk D$(A D$xH |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L D$(H D$ L d$hN D$pA \$ M \$ f d$hM D$pA |$0L d$`H L$XL l$PL L$@L \$8H \$XH T$(H |$0L D$HL L$@L \$8L d$`L |$ H t$(L D$0L |$ H t$(L D$0L D$PI T$`I T$HH T$HH D$PL \$`H \$@I \$@Hk l$xL d$`H T$XL |$pL T$hH \$hH T$XH \$@L d$`L l$xL |$ H t$(L D$0L |$ H t$(L D$0L ,qH9 \$xL t$pM d$xM D$(L t$pL t$pL \$xJ 4#H9 D$(L |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L t$(1 v?UH D$HH |$`M |$ H t$(L |$ H t$(L l$HM9,$u d$`D \$GE d$FE \$GD d$FH \$GD \$FH d$`I D$hH t$XH \$hL9 T$HH \$HL9 L$xL L$pM D$xH D$PL \$GE |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L \$`f \$@H L$hH \$`J L$8M9 L$hH \$`L \$@L d$0D d$0M L$hH \$`L \$@L d$0D L$8M9 L$@J L$hH \$`L \$0D \$0M \$@J L$hH \$`L \$0D L$@H |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L \$`f \$@H L$hH \$`J L$8M9 L$hH \$`L \$@L d$0D d$0M L$hH \$`L \$@L d$0D |$ H t$(L D$0L L$8L T$@f |$ H t$(L D$0L L$8L L$xH \$pL D$@H L$xM T$HH T$HM9 D$@H L$xH \$pH T$HD \$0I d$xH L$HL \$0M \$PJ L$PL T$pO L$HH \$pH d$8I L$HL d$8M \$PJ L$PL T$pO L$HH \$pH |$ H t$(L D$0L |$ H t$(L D$0L |$XL T$PH d$xN d$pN d$hH T$HM D$`H D$XL L$xL T$HL D$XH t$pL D$PL L$hL T$HL D$`L |$XI L$HH |$ H t$(L D$0L |$ H t$(L D$0L t$xL L$hH \$`M D$xH T$hL l$`O D$@H L$0H D$0H L$hH9 \$`O l$@L9 D$8H D$8H |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L \$8I) L$@L D$@H |$ H t$(L D$0L |$ H t$(L D$0L D$pH \$xI) D$PI T$XI T$HH T$HH D$pH \$xH D$PL \$XH \$@J \$@I \$xH T$pH |sH9 |$ H t$(L D$0L |$ H t$(L D$0L L$xH L$xL t$HL ,qH9 \$8L d$PH t$0M L$xH \$pH t$0L L$xH \$pH t$0L \$8J d$PL \$HM \$@J L$@L T$pO l$PO |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L M9,$u M9,$u l$ M9,$u |$`D |$pD D$`H \$hH L$pH |$xH T$HH T$@H D$XH \$PH D$XH T$@H \$PH |$ H t$(L D$0L |$ H t$(L D$0L M9,$ H H9K uVH H9P0uJ P88S8uA P98S9u8H D$(H \$0H T$0H T$(H vtUH S H9P uBH P(H9S(u8H D$(H \$0H T$0H T$(H S(H9P(u`H D$(H \$0H T$(H t$0H D$(H \$0H |$8H \$XH D$(H D$0H D$(H L$PH L$XI T$8H \$ H T$8H \$ H \$ H vJUH D$ H T$ H v/UH l$ M9,$u T$ H v/UH l$ M9,$u D$ H \$ H \$ H \$ H \$ H \$ H D$ I D$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H \$ H L$ I L$0H D$(H \$0H L$(H \$0H L$(H \$0H L$(H \$0H L$(H \$xH D$pH D$HH \$(H D$@H \$0H L$HH L$@I L$pH D$HH \$(H D$@H \$8H L$HH T$@I T$pH T$HD L$PH D$XH D$HH \$xH \$(H D$HH \$(H D$pH L$pH \$8H |$@D |$PH L$8H L$PH D$@H D$@H \$01 D$`H \$PH D$HH D$HH D$(H D$PH D$xH D$PH \$(H D$HH \$@H L$PH L$HI L$xH D$PH \$(H D$HH \$8H L$PH L$HI L$xH L$xH L$xH L$PD |$XH L$XH D$`H D$PH |$ H |$ H D$XH \$0H D$PH \$HH L$XH T$PI D$XH \$0H D$PH \$@H L$XH L$PI D$XH \$0H D$PH \$8H L$XH L$PI |$`t D$`H \$hH L$(Hi D$XH \$0H D$PH \$HH L$XH T$PI D$(H D$XH \$0H D$PH \$@H L$XH L$PI D$XH \$0H D$PH \$8H L$XH L$PI |$`t D$`H \$hH \$pH \$pH :POSTu/H T$XH L$XH D$xH T$xH |$hH D$hH D$hH \$pD T$hH \$PH \$xH D$`H >heapu D$HH \$PH \$PH \$pH D$hD \$@H \$PH L$@H T$XI \$hH D$`I D$`H |$ H |$ H D$PH L$PHi D$xH L$xH \$81 D$XH D$XH L$XH L$HH L$HH T$hH \$`H \$@H \$`H L$@H T$pI |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L v@UH l$ M9,$u D$@H D$(H L$ H T$ H D$HH T$XH D$xD |$@H L$xH L$XH \$PH L$pH L$pH L$XH \$hH L$`H L$`H |$PH |$PH v%UH D$@H \$pH L$xH T$PH D$hH \$HD D$hH D$PH D$PH \$pH L$xH t$PH D$`H \$@H D$XH \$8D D$`H D$XH D$Pf |$ H |$ H t$(f vWUH D$hH \$pH L$xH D$hH \$pH L$0H D$@H \$HH L$PH |$XH t$`L D$hL D$@H \$HH L$PH |$XH t$`L D$hL \$wE d$vE \$wD d$vH D$(A \$wD \$vH T$xH \$xL9 D$(L \$wE |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$(L D$xH T$pH T$pH9 D$(L D$xH T$pH D$xH T$pH T$pH T$xL T$xM9 D$(A |$pD |$pM9 D$(A |$pD |$pJ |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L =}}V D$xH T$pH D$xH9 D$(L D$xH T$pH T$pH9 D$(L D$xH T$pH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L =%xV d$(A D$(L \$pI \$pMk D$(L d$xI d$xMk D$(L |$ H t$(L D$0L |$ H t$(L D$0L |$XL T$PH d$xN d$pN d$hH T$HM D$`H D$XL L$xL T$HL D$XH t$pL D$PL L$hL T$HL D$`L |$XI L$HH |$ H t$(L D$0L |$ H t$(L D$0L d$(A D$(L L$pLk D$(A D$pH D$xMk D$(A D$xH |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L D$(H D$ L d$hN D$pA \$ M \$ f d$hM D$pA |$0L d$`H L$XL l$PL L$@L \$8H \$XH T$(H |$0L D$HL L$@L \$8L d$`L |$ H t$(L D$0L |$ H t$(L D$0L D$PI T$`I T$HH T$HH D$PL \$`H \$@I \$@Hk l$xL d$`H T$XL |$pL T$hH \$hH T$XH \$@L d$`L l$xL |$ H t$(L D$0L |$ H t$(L D$0L ,qH9 \$xL t$pM d$xM D$(L t$pL t$pL \$xJ 4#H9 D$(L |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L vKUH \$@H L$HH |$ f l$8M9,$u S(H9P(u_H P0H9S0uUH D$(H \$0H T$0H T$(H T$0H T$(H S(H9P(u_H P0H9S0uUH D$(H \$0H T$0H T$(H T$0H T$(H D$(H \$01 D$@H =,XV \$@H \$@H \$@H =SWV L$@I =XVV \$`H L$hH D$XH D$0H \$@H T$@I L$XH D$8H t$Xf L$0H L$@H L$_H ={TV D$`H =,TV L$`H L$`H L$^L T$`H L$^L T$`H L$^L |$hD |$xD T$hH D$pH T$xH T$`H T$hH L$^L T$`H T$`H T$`H \$`H |$hH L$hH D$pH T$hH |$hH L$hH D$pH T$hH |$hH L$hH D$pH T$hH |$hH L$hH D$pH T$hH |$hH L$hH D$pH T$hH |$hH L$hH D$pH T$hH L$hH D$pH T$hH L$hH D$pH T$hH L$hH D$pH T$hH \$XH D$`H D$xH D$`H \$Xf \$xH |$ H t$(L D$0L |$ H t$(L D$0L D$0H L$0I D$(H L$(I D$0H \$8H T$8I L$0H |$0H T$HH D$8H \$PH D$(H T$XH T$8H T$`H t$PH t$hH |$(H |$pH |$@H |$xH L$XH L$(H T$0H L$@H L$`H L$8H D$hH \$@H \$pH T$XH D$PH L$8H D$HH L$8H D$xH D$XH \$`H L$@H \$PH |$xH D$pH v(UH \$8H D$PH \$XH D$PH D$XH \$@D |$hD |$xD T$hH D$`H L$HH |$hH T$HH T$`I T$XD ==CV v`UH D$(H \$0H v9UH |$xL L$pH D$`H ="V D$(H L$PH D$(H L$ H T$HH L$ H \$hH T$HH L$PH T$HH v[UH D$HH |$`H D$HH L$XH \$PH T$HH |$`H9 D$(H L$0H \$ H \$PH T$ H T$0H D$(H T$HH v2UH L$ H \$`H L$hH D$XH t$8H L$hH \$`H T$XH L$hH \$`H t$8H L$hH T$@H \$`H t$8H T$XH D$(H \$0H |$0@8w r H9w u3H B(H9G(u)H T$08J8 vQUH D$(H \$0H T$08J vRUH L$(H |$0H t$8L D$@L L$HD T$PH D$ H |$ H t$(L D$0L L$8D |$ H t$(L D$0L L$8D M9,$ v$UH M9,$u M9,$u vRUH L$(H |$0H t$8L D$@L L$HD T$PH D$ H |$ H t$(L D$0L L$8D |$ H t$(L D$0L L$8D M9,$ v$UH M9,$u M9,$u v;UH L$ H =82V M9,$u M9,$u M9,$u vRUH L$(H |$0H t$8L D$@L L$HD T$PH D$ H |$ H t$(L D$0L L$8D |$ H t$(L D$0L L$8D M9,$ v$UH M9,$u M9,$u v;UH L$ H M9,$u M9,$u M9,$u vRUH L$(H |$0H t$8L D$@L L$HD T$PH D$ H |$ H t$(L D$0L L$8D |$ H t$(L D$0L L$8D M9,$ v$UH M9,$u M9,$u v;UH L$ H =8-V M9,$u M9,$u M9,$u vRUH L$(H |$0H t$8L D$@L L$HD T$PH D$ H |$ H t$(L D$0L L$8D |$ H t$(L D$0L L$8D M9,$ v$UH M9,$u M9,$u v;UH L$ H M9,$u M9,$u M9,$u vRUH L$(H |$0H t$8L D$@L L$HD T$PH D$ H |$ H t$(L D$0L L$8D |$ H t$(L D$0L L$8D M9,$ v$UH M9,$u M9,$u v;UH L$ H =8(V M9,$u M9,$u v.UH D$ H \$(H L$0H |$ H |$ H l$ M9,$u D$@H L$@H =K&V T$@L D$XH B8L9 \$8L \$8H L$8L D$0H D$HH T$0L D$@I T$8I =f%V T$HI T$PI @8H9 \$8H \$8H L$8H T$0H D$HH) T$0L D$@I T$8I L$HI =V$V T$`H T$hH D$@H T$`H T$hH D$@H T$`H T$hH D$@H \$@H \$HH D$@H L$ H D$(H L$ H \$(H T$@H T$@H =J"V T$ I T$@H D$@H \$HH L$ H D$(H L$ H \$(H T$@H = !V T$ I T$@H D$@H \$HH L$ H D$(H L$ H =A V \$(H T$@H T$ I T$@H D$8H \$ H D$0H \$@H L$8H L$0I |$HH L$HH D$(H D$HH |$ f D$pH L$@H T$HH L$HH T$@I T$pH |$`t L$`H |$hH D$PH \$XH D$`H |$xH \$hH L$pH T$xL \$`M |$@t \$@H L$HH D$`H \$hH \$hH L$pH D$`H \$hH L$pH t$pH \$xH vdUH \$(H D$ H L$ H L$(I D$PH D$xH \$pH t$@H \$hD D$8H L$8H L$8H T$PH \$hH T$8H D$`H D$xH \$pH D$XH \$0H \$@H L$HH L$@H T$HH L$@H t$@H vdUH \$(H D$ H L$ H L$(I D$`H \$hfD D$(H L$0H D$8H \$@L D$(L T$HH L$0H L$XH D$8H \$HH L$@D L$8H \$HH L$@f L$0H \$PH L$0H |$`D |$pD L$`H L$pH L$XH D$pH \$ H D$hH \$xH L$pH L$hI |$(D |$8D |$HD |$XH L$(H L$8H L$@H L$HH L$PH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$8H \$ H D$0H \$(H L$8H L$0I |$@H L$@H |$ H |$ H D$8H \$ H D$0H \$(H L$8H L$0I |$@H L$@H D$@H |$ H |$ H v6UH D$0H \$8H l$0M9,$u D$(H \$0H T$0I L$(H l$(f M9,$ L$xH D$hH \$pH \$0H \$8H T$@H T$0H D$8H \$hH L$pH |$HH L$xH L$HH D$PH D$hH \$pH |$HH L$xH L$HH D$PH D$hH \$pH v6UH D$0H \$8H l$0M9,$u D$(H \$0H T$0I L$(H l$(f M9,$ D$xH |$0H T$8H |$HD |$XH L$HH L$PH L$XH D$`H T$0H D$8H \$xH t$@H T$0H D$8H \$xH D$xH v6UH D$0H \$8H l$0M9,$u D$(H \$0H T$0I L$(H l$(f M9,$ D$xH t$0H T$@H \$8D |$Xt L$HH T$XH L$`H T$8H D$xH D$PH L$0H \$xH D$@H v6UH D$0H \$8H l$0M9,$u vPUH D$(H \$0H T$0H T$(H S(H9P(uWH D$(H \$0H T$0H T$(H T$0H T$(H v[UH D$(H \$0H T$(H v^UH D$(H \$0H T$0H T$(H vYUH D$(H \$0H L$(H \$0H9S D$0H L$0H L$0H L$0H L$0H L$0H L$0H L$0H L$0H T$0H L$0H L$0H L$0H L$0H L$0H L$0H L$0H L$0H L$0H L$0H L$0H L$0H L$0H L$0H L$0H L$0H L$0H L$0H |$0H \$@H L$XH D$`H \$hH L$XH READ DY=1H L$(H D$@H \$0H T$pH D$0H \$8H T$HH T$PH T$pH \$8H D$0H L$0H |$8H T$HH T$PH |$01 D$0H \$8H v%UH M9,$u :infou :warnu< :debuu :errof =QKR vEUH D$ H \$(H v%UH M9,$u v;UH M9,$u v_UH v%UH M9,$u \$0H L$0H9 D$8f |$PD |$@H |$PH D$@H \$HH L$PH T$XH D$`H L$pH D$xH L$pH |$hH L$8D L$`H L$8H T$hH |$PH D$@H D$PH L$@H \$XH |$HH D$PH \$XD D$PH L$@H \$XH |$HH |$PH D$@H \$HH L$PH T$XH D$PH \$XH L$@H |$HH v-UH M9,$u v(UH l$ f M9,$u v\UH L$xH D$hH \$pH T$xH L$pf D$HH \$PH L$pH D$HH L$pH D$hH |$hH t$pL |$hH L$XH \$PH D$HH T$XH L$PH9 D$(H \$0H D$(H |$HH 8ont& 8onlyu2 8debuu v%UH v*UH \$ H M9,$u v&UH v;UH D$0H L$\H L$\H L$XH L$XH L$TH L$TH L$PH L$PH L$LH L$LH L$HH L$HH L$DH L$DH L$@H L$@I D$`H L$xH D$`H L$xH T$xH |$pJ D$xI) L$pL9 |$xH \$pH |$xI \$pL D$xH L$pH D$pH L$xH D$pH L$xH T$hH T$hI \$0H ;sha ;sha D$(H \$0H D$(H p09Y v*UH \$`H D$XH L$hH |$pH \$`H R H9 t$(H9 D$XH L$hH \$`H t$(H |$pH @u2H D$XH L$hH \$`H t$(H |$pH) @|YH \$@H T$8H |$0H T$ H t$0I t$8H! L$@I D$XH L$hH |$8H D$XH L$hH |$8H D$HH |$ D |$(D |$8D |$HD \$ H |$hD vTUH L$@H L$HH L$ H L$(H L$0H |$PH |$XH D$PH D$P1 D7qD m,MD LwH'D o.hD ~o-6 " D4 D L4$D D4,D \4@ T4D T4LD D4`D L4dD D4lD L4 A D4 D L4$D \4( D4,D D40D L44D \48 D4 \$ H t$(H t5rf \$ H t$(H CpfA vKUH l$8M9,$u v,UH =/iT vCUH vCUH =}hT v&UH |$0D |$@D L$(H T$ H |$PH \$PH |$Xf |$8D |$HD T$XH T$`I T$XI L$`H T$XH |$hf \$hH |$pH t$hH |$HD |$XD |$hH |$8D |$HD |$XH L$hM |$ H |$ H |$0D |$@D |$PH D$0H L$pH D$hH t$xH= D$`H L$pL D$`L) D$hL) L$xH D$hH L$pH v%UH v(UH l$(f M9,$u D$@H t$`H |$XH L$PH \$HH D$@H D$@H \$HH L$PH |$XH t$`I L$PH T$@H \$HH t$`H |$ H |$ H D$@H t$`H |$XH L$PH \$HH D$@H \$HH L$PH |$XH t$`I L$PH T$@H \$HH t$`H |$ H |$ H !"#$%&'(H )*+,-./0H 12345678H L$xH 9:;<=>?@H ABCDEFGHH IJKLMNOPH QRSTUVWXH YZ[\]^_`H abcdefghH L$HH ijklmnopH L$PH qrstuvwxH L$XH yz{|}~ L$`H L$hH L$pH L$(H L$0H L$8H L$@H \$xH t$HH =;YT =xST =SST @8`$H =zXT v&UH |$HH T$`H T$`H T$XL T$pI L$hH T$`H L$hH T$`H \$pH T$hH D$HH T$hD \$ H L$(H \$ H L$(H |$0D |$@D D$RH D$ H D$ 1 L$xH L$ H L$(H D$8H \$@H L$HH |$PH t$XL D$`L D$8H \$@H L$HH |$PH t$XL D$`L \$pL \$pL d$hL |$xH L$xL L$xI d$ H T$(L \$hH L$xH D$8H \$@H L$HH |$PH t$XL D$`L D$8H \$@H L$HH |$PH t$XL D$`L \$pM T$hL9 T$hL \$pL |$xH T$xH T$xL D$ H D$(H \$pH T$pH \$hH L$x1 D$8H \$@H L$HH |$PH t$XL D$`L D$8H \$@H L$HH |$PH t$XL D$`L v2UH vlUH fA L$(fE o~pH og0fD ogPfD ogpfD oX fA oX0fA oX@fA oXPfA oX`fA oXpfA trfA o^ fA o^0fA o^@fA o^PfA o^`fA o^pfA R fA Z0fA b@fA jPfA r`fA zpfA |$pH oo0fE oX fA o\$ fE ooPfE oX0fA o\$0fE oopfE oX@fA o\$@fE oXPfA o\$PfE oX`fA o\$`fE oXpfA o\$pfE trfA o^ fA o^0fA o^@fA o^PfA o^`fA o^pfA R fA Z0fA b@fA jPfA r`fA zpfA |$pH og0fE o\$ ogPfE o\$0 ogpfE o\$@ o\$P o\$` o\$p r>fA r>fA \$ A \$0A \$@A \$PA \$`A \$pA \$|I oT$ o\$0 od$@ ol$P ot$` o|$p oo0fE oX fA oZ fE ooPfE oX0fA oZ0fE oopfE oX@fA oZ@fE oXPfA oZPfE oX`fA oZ`fE oXpfA oZpfE \$|fE trfA oZ fA oZ0fA oZ@fA oZPfA oZ`fA oZpfA r>fA r>fA |$,D |$8H \$HH D$pH L$HH9 T$P1 v`UH |$,D v,UH D$ H vpUH \$HD D$HH |$pD T$pH |$$H |$4D |$@H \$4H9 D$@1 |$PD |$`H T$hH D$pL T$(H D$0H T$8H D$`H D$ L T$xH \$`I \$8L |$hL T$xL l$pM T$PH D$XL T$@H D$HL \$HH \$@L D$XL L$PL) L$ L T$0M \$(M) T$pH D$xH D$@H T$XH D$`H T$HH D$PH T$hH L$PI L$@H L$pL D$xM \$HL L$`L L$XI l$PM T$0H D$8L T$ H D$(L d$(L d$ L D$8M |$0L) D$hL T$@L D$PH L$8H D$0L! l$ H T$PH L$(H L$ H T$xH T$hH D$pH T$XH D$`H T$PH T$(H D$0H D$ H t$PH |$`H |$XL T$pL T$hL l$xM) T$HI T$8H D$@L \$@H \$8L L$HM) L$ L \$0M d$(M) |$xD D$ D l$`D |$@D D$8D T$8H T$@H T$HH T$PH L$XH T$pH T$`H T$ H L$(H T$xH T$0H T$hH |$`D D$XH D$`H D$`H D$Pf D$Hf D$@f D$8f D$0f D$(f D$ f |$@D |$PD |$`H \$pH |$ D |$0H L$pH9 T$x1 voUH |$@D |$PD |$ D |$0H v,UH D$ H vxUH \$XD |$ D D$XH |$(D |$8H |$HD |$XD |$hH \$HH9 D$h1 |$xD T$ H D$(L T$0H D$8H D$hH T$`H D$pH T$@H D$HH T$PH D$XH T$hM \$xL L$(M L$ L \$8M \$0L d$HM d$@L l$XM l$PL |$pM \$`L) L$xH T$(H D$0H D$ H T$8H D$@H L$HH T$ H t$0H |$(M L$@H t$8H) D$HL t$0H \$(L D$@L T$8M T$xH T$PH L$xH L$pH L$hH L$`H L$XH L$PH L$0H T$8H! t$(H t$8I! \$0H! L$(H L$ H I(H) T$@H D$8H D$0H T$(H D$8H D$ H D$8H t$@H) \$ H d$0L |$(M t$0L D$xH |$xH T$pH T$HH L$pH L$hH L$`H L$XH L$PH L$HH D$XH T$8H D$@H D$PH T$HH T$(H D$0H D$(L L$PM T$@L \$HM d$8M l$0M D$ H L$ L l$XM T$`H L$xH L$pH L$hH L$`H T$(H T$ H w L! W(I! L$(H L$ H |$ D |$xD D$pD L$hD T$`D \$PD d$HD T$(H T$0H T$8H T$@H L$HH T$PH T$`H T$hH T$pH T$xH T$ H T$XH |$pD D$hH D$`H D$XH D$PH D$pH D$pH D$HH D$pH D$pH D$@H D$pH D$pH D$8H D$0H D$(H D$ H |$VD |$XD |$hD |$xD |$&D |$6D |$FH |$VD |$XD |$hD |$xD |$&D |$6D |$FH v,UH D$ H \$pD |$(D |$8D D$pH |$.D |$>D |$NH |$^D |$`D |$pD \$^H9 t$hM l$HL T$hM T$HM L$xL d$pL t$`L l$XL T$PM T$@I \$8I D$0I L$(I d$ H L$@H L$8H L$0H L$(H L$ H L$xH t$pL \$hL d$`L D$XL l$PH T$HM T$@I L$8H t$0I \$(I d$ I L$@H L$8H L$0H L$(H L$ H D$xH T$pH |$hL L$xL D$`H L$XH t$PH L$pI! L$hI! L$`I! L$XL! D$PH D$HH D$@H D$8H D$0H D$(H D$ H D$8H D$ H I@H) t$ L d$8I l$ H t$(I D$0I T$8H D$@H T$0L |$0I l$0I d$0I \$0I T$0I L$0I D$0I T$`I L$XI D$PH T$@H D$HH T$8H) t$8H D$8I L$8I L$(L L$8I L$ L L$8I L$8L T$HM L$@M) T$(L \$`M \$ L d$XM l$PM D$xH D$pH D$hH T$xH T$pH T$hH T$HH D$PL d$XH T$(H D$0L D$ I) d$PM L$HM T$@I |$8H L$XH \$ I |$ I T$ I T$ I T$ I T$0L T$(L) T$ M D$@L L$8M D$xH D$pH D$hH D$`H T$xH T$pH T$hH T$`H T$@H T$8H T$0H T$(H w L! T$ H w(L! w0L! w8L! W@I! L$@H L$8H L$0H L$(H L$ H D$@D L$pD |$PD D$HD T$8D \$0D d$(D T$ H T$(H T$0H T$8H L$HH T$PH T$XH T$`H T$hH T$pH T$xH T$@H |$`D |$hD |$xD D$`H D$`H D$XH D$`H D$`H D$PH D$`H D$`H D$`H D$`H D$@H D$`H D$`H D$8H D$`H D$`H D$`H D$0H D$`H D$`H D$`H D$(H= D$`H D$`H D$`H D$ H= D$ H L$ H L$ I T$(H T$0H T$8H T$(H T$0H T$8H T$PH D$PH |$`D |$pH |$@D |$PH D$@H |$$D |$0H v3UH D$HH D$HH |$(H \$PH D$HH \$HH D$HH \$pD |$0D |$@H D$PD |$ H D$PH v,UH D$ H |$DD |$PH \$hH \$hH T$xH L$pH |$(D |$4H T$pH L$xH9 \$`H T$pH \$`H L$xH t$pH \$pH L$xH v,UH D$ H |$`D |$,D |$8H D$`H \$HH L$HH t$XH \$PH \$PH L$X1 |$xD D$xH |$XD |$hH D$Xf D$xH D$XH D$xH D$Xf |$8D |$HH D$XH D$8H D$8H \$XH D$XH \$8H \$XH D$XH D$XH L$8H D$8H D$8H \$8H D$8H \$xH D$8H \$XH D$8H D$XH D$XH \$xH |$xD D$xH |$XD |$hH D$XH |$8D D$8H |$(H \$8H D$8H L$8f D$8H D$8H D$xH L$XH D$XH D$XH D$xH \$XH D$XH D$xH \$xH D$8H D$XH D$XH D$XH D$XH D$0H \$8H L$@H |$HH T$0H T$8H T$@H T$0H T$8H T$@H D$0H |$hD |$xD |$HD T$HH |$(D |$8H T$hH t$HH t$(H |$(H L$(H t$(H |$pD |$PD T$PH |$0D |$@H T$pH t$PH t$0H T$ H |$ H |$ H v3UH |$xD |$XD L$XH |$8D |$HH L$xH T$XH T$8H t$(H \$0H t$ H \$0@ T$(H D$ H D$`H \$hD |$0D |$@H |$ H D$PH D$HH D$@H D$8H D$0H D$(H D$ H T$xH D$hH T$`H T$pH \$hH T$pH \$hH L$xH D$`D D$`H L$XH v[UH |$8H L$8H T$@H t$HL D$PL D$8H D$XH D$XH D$XH T$XH D$8H |$XD |$hH D$XH D$XH |$8D |$HH D$8H D$8H D$8H D$ H D$(H D$0H D$XH D$XH D$XH \$xD |$8D |$HH D$XD |$(H L$xH L$X1 D$hH \$pD |$8D |$HD |$(H D$8H D$8H L$pH D$8H D$8H D$8H D$8H D$8H D$8H D$8H D$8H D$8H D$8H L$pH D$8H D$8H L$pH D$8H D$8H D$p1 D$8H v,UH |$ H D$ H D$ H D$ H D$ H D$ H \$HH t0H D$@D |$ H L$ H L$(H D$@H D$@1 t0H |$PD |$`H T$PH T$XH T$`H L$hH |$ H |$ H v,UH D$ H \$pD |$8D |$HD |$(H \$8H T$8H T$@H T$HH T$PH T$ H T$(H T$0H D$(H \$0H L$0H L$8H L$8H L$0H L$0H T$(H L$8H T$(H L$0H L$8H v,UH D$ H D$HH \$PD |$(H T$HH D$PH L$ H L$(H L$0H |$XD |$hD |$8D |$HD |$(H D$XH D$XH D$XH D$XH D$8H D$XH D$8H L$XH D$8H D$8H D$8H D$XH D$8H D$8H D$XH D$8H D$8H D$8H D$8H D$XH D$8H D$8H D$8H D$8H D$8H L$XH D$8H D$XH D$8H D$XH D$XH |$8D |$HD |$XD |$hH L$8H D$8H D$8H D$8H D$ H D$0H L$0H T$xH \$xH L$0H |$(H T$(H t$(H D$ H L$ H L$ H D$ H |$ D |$0H D$ H D$ H L$ H L$ I D$`H T$ H T$(H T$0H T*8H T$8H U)lH T$@H :T^8rv T$HH &,oH T$ H T$(H T$0H T$8H T$@H T$HH T$`H D$`H |$PD |$`D |$pH D$PH |$ D |$0D |$@H v3UH D$XH D$XH |$(D |$8H \$`H D$XH \$XH D$XH |$@D |$PD |$`H D$pD |$ D |$0H D$pH v,UH D$ H |$XD |$hD |$xH |$(D |$8D |$HH \$(f v,UH D$ H |$pD |$(D |$8D |$HH D$pH \$XH L$XH t$hH \$`H \$`H L$h1 |$xD D$xH |$HD |$XD |$hH D$xH D$HH D$HH \$xH |$(D D$xH \$HH \$xH D$xH D$xH L$HH D$HH D$HH \$HH D$HH D$HH \$xH D$HH D$xH D$xH |$xD D$xH |$HD |$XD D$HH |$(D |$8H \$HH D$HH D$HH D$HH L$xH D$xH D$xH \$xH D$xH D$HH D$xH D$xH D$xH D$xH D$0H \$8H L$@H |$HH T$0H T$8H T$@H T$0H T$8H T$@H D$0H |$XD |$hD T$`H |$(D |$8D |$HH t$XH t$(H D$ A D$ A |$(H L$(H t$(H |$`D |$pD T$`L D$hH |$0D |$@D |$PH t$`H t$0H T$ H |$ H |$ H v3UH |$hD |$xD L$hH T$pH |$8D |$HD |$XH T$hH T$8H t$(H \$0H t$ H `syH \$0@ T$(H D$ H |$@D |$PD |$`H |$ D |$0H |$pD D$hH D$pH D$pH D$pH D$pH D$XH D$PH D$pH D$pH D$HH D$pH D$pH D$@H D$pH D$pH D$0f D$(H D$ H D$ H L$ H L$ I D$xD |$&D |$(D |$8D |$HD T$(H T$0H T$8H `kM= T$@H T$HH T$PH T$XH T$`H 9)jx T$(H T$0H T$8H '>f,H T$@H T$HH T$PH T$XH T$`H T$xH D$xH |$hD |$pD D$hH |$&D |$(D |$8D |$HD |$XH v3UH D$pH D$pH |$ D |$0D |$@D |$PH \$xH D$pH \$pH D$pH |$XD |$`D |$pD |$(D |$8D |$HH v,UH D$ H |$nD |$pD |$,D |$.D |$>D |$ND |$^H v,UH D$ H |$.D |$0D |$@D |$PD |$`H \$pH L$pH \$xH \$xH |$`D |$hD |$xD D$`H D$`H |$ D |$0D |$@D \$`H L$`H D$`H D$`H \$`H D$`H D$`H D$`H t$`H |$`D |$hD |$xD D$`H |$ D |$0D |$@D |$PH \$`H D$`H D$`H D$`H D$`H T$`H D$0H \$8H L$@H |$HH T$0H T$8H T$@H T$0H T$8H T$@H D$0H |$pD |$xD T$pD |$(D |$0D |$@D |$PD |$`H t$pH t$(H |$(H L$(H t$(H |$xD T$xD |$0D |$8D |$HD |$XD |$hH t$xH t$0H T$ H |$ H |$ H v3UH |$8D |$@D |$PD |$`D |$pH T$8H t$(H \$0H t$ H \$0@ T$(H D$ H |$XD |$`D |$pD |$(D |$8D |$HH vHUH D$(H |$&D |$(D |$8D |$HD D$'QH L$(H L$0H L$8H L$@H L$HH L$PH L$XH L$`H |$xD L$xD |$0D |$8D |$HD |$XD |$hH L$xH L$0H L$ H L$ H |$ Lk D$(J |$ I ==MR t$(H t$(H L$ H L$(H L$0H L$8H L$@H L$HH =pKR |$`D |$pD L$hH |$0D |$@D |$PH L$`H L$0H L$ H L$ H t$ Hk |$(H t$ H |$(f =4HR t$(H t$(H =;GR D$@H D$$j T$(H T$0H T$8H A2VH L$(H L$0H 9C#U L$8H |$pD |$PD L$PH |$0D |$@H L$pH L$PH L$0H L$ H L$ H =1DR t$ Hk |$(H t$ H |$(H t$(H t$(H =-BR ~d$ fE oF fA oN0fA oV@fA o^PfA oYPfA o_PH o_pH L+%} L$pH T$@L \$HL d$PL t$`L |$hH |$pH t$@L |$HH |$PH t$ L |$(H |$0H t$ L |$(H |$0H o\$ od$0 ol$@ ot$PfA oL$` oT$p t$ L |$(H |$0H T$@L \$HL d$PL t$@L |$HH |$PH t$`L |$hH |$pH T$@L \$HL d$PL l$XL l$PH T$@L \$HL d$PL T$@L \$HL d$PL l$XL t$ L |$(H |$0H T$ L \$(L d$0L l$8H1 T$`L \$hL d$pL T$ L \$(L d$0L l$8L t$`L |$hH |$pH T$`L \$hL d$pL l$xH1 T$`L \$hL d$pL t$ L |$(H |$0H )E\\*=H c%QH D$0H D$(H D$ H L$ H L$ I \$0I L$(H L$(I t$ I 8d H vIUH D$(H L$ H D$(H T$0H vdUH D$0H v&UH D$@H Q\=n L$ H L$(H H@Vi L$0H L$8D L$@H |$xD L$xH |$HD |$XD |$hH L$HH L$XH T$hH \$pH L$`H \$HH |$XD |$`D |$pD |$(D |$8D |$H1 |$ H t$(L |$ H t$(L D$@H \$HH L$PH |$XH T$PH t$XH9N L$PH D$HH T$@H \$XH D$(H T$@L T$PI T$@H D$(H H H! vLUH vpUH S H+Q H |$ D |$0D |$@D |$HD |$XD |$hD |$pD D$@H D$@H D$@H D$hH D$hH D$hH D$hH \$(H t0H |$ f D$0H D$XH L$@H L$ H L$HH L$(H L$PH L$0H L$XH L$8H L$`H |$0D |$@H \$PH |$ H D$pH T$X1 H13H s H1 P H1s D$xH |$8D |$@D |$PH D$8H D$`D |$(H T$`H D$xH R I! V H! |$hD |$pD |$@D |$HD |$XD |$ D D$hH D$@H D$hH D$@H D$@H D$hH D$@H D$hH D$hH L$@H D$@H D$hH D$@H D$hH L$@H D$@H D$hH D$@H D$@H D$hH D$@H D$@H D$@H D$@H D$hH L$@H D$@H D$hH D$@H D$@H D$hH D$@H D$@H D$@H D$@H D$hH L$@H D$hH D$hH D$hH |$hD |$pD D$hH D$(H D$ H T$(H T$8H |$@D |$HD |$XH T$ H D$0H D$@H D$@H \$0H! D$HH! D$PH! D$XH! D$`H! \$8H H L! A Hk A Hk A Hk A Hk A Hk vOUH D$0H \$8H L$@H |$HH D$0H \$8H L$@H D$@H \$HH L$PH |$XH T$PH t$XH9N L$PH D$HH T$@H \$XH D$(H T$@L T$PI T$@H D$(H L$`H D$PH \$XH t$pH |$hH L$`H T$PH \$`H |$pH T$`f \$h1 D$8H \$(H L$0H \$`H D$8H L$0H T$(H L$0H T$(H D$8H L$XH T$8I t$(H t$0H |$ H |$ H S H9 L$HH \$@H D$XD |$`D |$hD |$xD T$`H T$hH T$xH T$pH D$PH L$0H T$8H D$8H L$0H D$8H L$0H T$PH L$0H L$8H T$PI t$XI T$@H T$HH |$ H |$ H D$@H D$(H D$0H D$HH \$8H \$ H T$HH \$@H |$0H T$HH L$ H9 D$HH \$PH L$XH T$PH L$(H D$0H \$`H |$(H L$(H T$0D \$PH 8P-52u(A 1u!H D$HI vOUH D$0H \$8H L$@H |$HH D$0H \$8H L$@H D$@H \$HH L$PH |$XH T$PH t$XH9N L$PH D$HH T$@H \$XH D$(H T$@L T$PI T$@H D$(H L$`H D$PH \$XH t$pH |$hH L$`H T$PH \$`H |$pH T$`f \$h1 D$8H \$(H L$0H \$`H D$8H L$0H T$(H L$0H T$(H D$8H L$XH T$8I t$(H t$0H |$ H |$ H S H9 L$HH \$@H D$XD |$`D |$hD |$xD T$`H T$hH T$xH T$pH D$PH L$0H T$8H D$8H L$0H D$8H L$0H T$PH L$0H L$8H T$PI t$XI T$@H T$HH |$ H |$ H D$@H D$(H D$0H D$HH \$8H \$ H T$HH \$@H |$0H T$HH L$ H9 D$HH \$PH L$XH T$PH L$(H D$0H \$`H |$(H L$(H T$0D \$PH 8P-52u(A 1u!H D$HI vOUH D$0H \$8H L$@H |$HH D$0H \$8H L$@H L$`H D$PH \$XH t$pH |$hH L$`H T$PH \$`H |$pH T$`f \$h1 D$8H \$(H L$0H \$`H D$8H L$0H T$(H L$0H T$(H D$8H L$XH T$8I t$(H t$0H |$ H |$ H S H9 L$HH \$@H D$XD |$`D |$hD |$xD T$`H T$hH T$xH T$pH D$PH L$0H T$8H D$8H L$0H D$8H L$0H T$PH L$0H L$8H T$PI t$XI T$@H T$HH |$ H |$ H D$@H D$(H D$0H D$HH \$8H \$ H T$HH \$@H |$0H T$HH L$ H9 D$HH \$PH L$XH T$PH L$(H D$0H \$`H |$(H L$(H T$0D \$PH 8P-52u(A 1u!H D$HI D$8H |$PH L$HH \$@H t$ H9p D$8H L$HH \$@H t$ H |$PH T$ H t$8H L$HH \$@H D$8H D$0H T$0H D$8H t$XH |$PH L$HH \$@L D$8H L$HH \$@H t$XH |$PL D$ H T$ H t$8H L$HH \$@H t$XH D$8H |$ H |$ H D$8H t$XH |$PH L$HH \$@L D$8H L$HH \$@H t$XH |$PL D$ H T$ H t$8H L$HH \$@H D$8H T$XH D$81 |$ H |$ H \$(H D$hH t$hI D$`H \$ H D$`H L$ H \$`H L$ H9 D$hH D$hH L$ H \$`H T$XH L$@H L$@H D$`H T$(H t$XH L$8H T$P1 \$0H \$0H D$`H L$8H T$PH D$(H9 D$`H L$8H T$8H t$(H T$HH D$`H T$HH L$HH \$@H D$8H D$ H T$ I \$8H L$@H D$(H L$(I |$ f t$ H D$8H \$@H L$HH D$8H L$HH \$@H t$ H T$ H t$8H L$HH \$@H t$@H D$8H L$HH t$ H t$(H t$ H T$ H |$ H t$ H vhUH D$(L D$(H |$(H t$(H L$ f L$ H L$ H9 L$ H D$ H \$ H T$8I D$hH D$8H T$8H \$hH T$0I D$`H D$0H T$0H \$`H \$xH \$xH T$(I D$XH D$(H T$(H \$XH \$pf |EH \$pH \$pH |$PL l$HM \$@L T$@I) \$PE1 \$@N |$HE1 \$ H T$ H D$PL T$PH D$HL T$HH t$@L t$@L T$H1 |$Pf T$0H T$0H T$(H T$(H T$ H T$ H T$PH d$8N |$8E1 D$8H T$8H T$HL T$PI T$PH D$@H D$@H L$PH T$PH |$hH D$hH L$0f L$0H L$0H9 L$0H L$PD D$'D |$XH |$HH L$PH D$'H |$HH T$8H L$8H t$'A t$(H t$(I |$ H t$(L D$0f |$ H t$(L |$0H t$0H t$(H T$(H L$(H T$(H @}dH t$ H T$ H T$ L v0UH y fL Y(fL y0fL Y8fL y@fL YHfL yPfL YXfL y`fL YhfL ypfL YxfL @xfH y fL Y(fL y0fL Y8fL y@fL YHfL yPfL YXfL y`fL YhfL ypfL YxfL y fL Y(fL y0fL Y8fL y@fL YHfL yPfL YXfL y`fL YhfL ypfL YxfL )E\\*=H D$HH D$hH T$HH \$hH T$HI \$hI \$HH \$HI |$hI c%QH D$@H D$`H T$@H \$`H T$@I \$`I \$@H \$@I |$`I D$8H D$XH T$8H \$XH T$8I \$XI \$8H \$8I |$XI 8d H D$0H D$PH =*~Q T$0H \$PH T$0I \$PI \$0H \$0I |$PI D$(H D$xH L$xH T$(H L$xI T$(I =:|Q \$(H \$(I t$xI D$ H D$pH =Y{Q L$pH T$ H L$pI T$ I \$ H \$ I t$pI vIUH D$(H L$ H D$(H T$0H vdUH D$0H vIUH D$(H L$ H D$(H T$0H vdUH D$0H =gwQ v`UH L$ H L$ H D$8H L$(H |$0H t$ H =&vQ L$0H L$0H \$8H T$@H vdUH D$0H =guQ v`UH L$ H L$ H D$8H L$(H |$0H t$ H =&tQ L$0H L$0H \$8H T$@H vdUH D$0H =gsQ v`UH L$ H L$ H D$8H L$(H |$0H t$ H =&rQ L$0H L$0H \$8H T$@H vdUH D$0H =gqQ v`UH L$ H L$ H D$8H L$(H |$0H t$ H =&pQ L$0H L$0H \$8H T$@H vdUH D$0H =goQ vjUH D$(H D$(H vpUH D$(H D$(H vjUH D$(H =.CO 5/CO D$(H vjUH D$(H D$(H v&UH L$pH L$xH L$pH L$PH L$XH L$`H L$hH L$PH J H9 v&UH D$pH D$xH D$pH D$PH D$XH D$`H D$hH D$PH J H9 *IBrH =ldQ D$8H \$@H D$@H t8H) L$ H T$8H L$ H D$HH |$`H L$XH D$XH= T$HH9J( L$ H L$HH L$HH T$HH =QaQ L$XH t$ H9 L$XH t$ H9 D$`I T$PL |$(H L$XH T$HH |$(L D$`L L$ L L$HH L$HH L$0H L$0H L$HH T$HH T$HH T$HH T$HH D$xH =s^Q \$xH D$0H t$xH |$0H D$pH T$xH T$pL T$pL T$pL T$pH T$xM D$pH L$XH D$hH T$xH T$xH D$h1 T$xH L$xH L$hH L$hH L$hH L$hH D$xM T$hH D$hH D$pH T$xH T$xH D$p1 T$xH =yYQ L$pI T$`H L$8H L$HH D$hL L$hH T$`H |$HH D$xH T$`L L$8H l$`L L$@I L$PH D$pL L$pH T$`H |$PH T$xL l$`L \$@M \$ H L$(H |$0H t$8L D$@L L$HL \$ H L$(H |$0H t$8L D$@L L$HL v3UH D$8L D$XH \$`H L$hH t$xH |$pH D$8H L$pH T$`H L$8H T$`H T$8H =TVQ \$'H L$8H D$(H L$(H T$8H T$(H t$8H L$pH9 \$hH T$8H t$8H F L9 L$0H D$@H D$@H L$0H t$8H t$8H N H9 D$8H \$@H \$@H |$ H |$ H t$ H L$(H t$ H p0H9p@u$H \$PH T$0H |$0f L$0L |$ H |$ H |$xL \$hH L$pL T$8H D$(1 T$@H |$xH D$(H T$@H |$xH t$0L D$(H D$HH L$pH \$hL T$8H D$(H T$HH t$0L |$ H t$(L |$ H t$(L |$0H T$0H |$ H t$(L D$0L |$ H t$(L D$0L \$HH L$PH |$XH T$HH L$PH \$HH |$XH T$HH t$hH |$ H t$(L D$0L |$ H t$(L D$0L |$0f T$0H =WBQ |$ H t$(L D$0L L$8f |$ H t$(L D$0L v,UH D$0H L$8H D$xH \$8H L$8H 8P-52 \$xH L$@H |$8H \$xH t$0L D$(H D$XH L$@H D$(H \$XH t$0H L$xH |$PH D$HH L$hH D$xH T$xI \$hH L$HH D$`H D$pH D$`H D$xH \$xH D$0H t$xH =b;Q |$0H D$pH T$xH T$pL T$pL T$pL T$pH T$xM D$pH L$XH D$hH T$xH T$xH D$h1 T$xH ='9Q L$xH L$hH L$hH L$hH L$hH D$xM T$hH D$hH D$pH T$xH T$xH D$p1 T$xH L$pI T$`H L$8H L$HH D$hL L$hH T$`H |$HH D$xH T$`L L$8H l$`L L$@I L$PH D$pL L$pH T$`H |$PH T$xL l$`L \$@M \$ H L$(H |$0H t$8L D$@L L$HL \$ H L$(H |$0H t$8L D$@L L$HL v3UH D$8L =t4Q |$8H T$8H L$0f L$0L L$0H9 L$0H =r2Q |$ H |$ H t$(f =t1Q |$8H T$8H L$0f L$0L L$0H9 L$0H =r/Q |$ H |$ H t$(f =t.Q |$8H T$8H L$0f L$0L L$0H9 L$0H =r,Q |$ H |$ H t$(f =t+Q |$8H T$8H L$0f L$0L L$0H9 L$0H =r)Q |$ H |$ H t$(f |$`H D$HH \$PH L$XL L$xH t$hH |$`L D$pH D$HH \$PH L$XH |$`H t$hL D$pL |$ H t$(L D$0L |$ H t$(L D$0L |$0H T$0H |$ H t$(L D$0L |$ H t$(L D$0L \$HH L$PH |$XH T$HH L$PH \$HH |$XH T$HH |$xL \$hH L$pL D$(1 T$@H |$xH D$(H T$@H |$xH t$0L D$(H D$HH L$pH \$hL T$8H D$(H T$HH t$0L |$ H t$(L |$ H t$(L D$0H \$8H L$@H t$PH |$HH T$0H \$@H |$PH L$8H T$@I t$HH t$PH |$ H |$ H |$`H D$HH \$PH L$XL L$xH t$hH |$`L D$pH D$HH \$PH L$XH |$`H t$hL D$pL |$ H t$(L D$0L |$ H t$(L D$0L |$0H T$0H |$ H t$(L D$0L |$ H t$(L D$0L \$HH L$PH |$XH T$HH L$PH \$HH |$XH T$HH |$xL \$hH L$pL D$(1 T$@H |$xH D$(H T$@H |$xH t$0L D$(H D$HH L$pH \$hL T$8H D$(H T$HH t$0L |$ H t$(L |$ H t$(L D$0H \$8H L$@H t$PH |$HH T$0H \$@H |$PH L$8H T$@I t$HH t$PH |$ H |$ H |$`H D$HH \$PH L$XL L$xH t$hH |$`L D$pH D$HH \$PH L$XH |$`H t$hL D$pL |$ H t$(L D$0L |$ H t$(L D$0L D$0H \$8H L$@H t$PH |$HH T$0H \$@H |$PH L$8H T$@I t$HH t$PH |$ H |$ H |$`H D$HH \$PH L$XL L$xH t$hH |$`L D$pH D$HH \$PH L$XH |$`H t$hL D$pL |$ H t$(L D$0L |$ H t$(L D$0L |$0H T$0H |$ H t$(L D$0L |$ H t$(L D$0L \$HH L$PH |$XH T$HH L$PH \$HH |$XH T$HH |$xL \$hH L$pL D$(1 T$@H |$xH D$(H T$@H |$xH t$0L D$(H D$HH L$pH \$hL T$8H D$(H T$HH t$0L |$ H t$(L |$ H t$(L D$0H \$8H L$@H t$PH |$HH T$0H \$@H |$PH L$8H T$@I t$HH t$PH |$ H |$ H t$hH |$ H t$(L D$0L |$ H t$(L D$0L |$0f T$0H |$ H t$(L D$0L L$8f |$ H t$(L D$0L v,UH D$0H L$8H D$xH \$8H L$8H 8P-52 \$xH L$@H |$8H \$xH t$0L D$(H D$XH L$@H D$(H \$XH t$0H L$xH |$PH D$HH L$hH D$xH T$xI \$hH L$HH D$`H D$pH D$`H |$0f L$0L |$ H |$ H |$8H T$8H \$0H L$(H T$0H T$(H |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$pH D$xH D$hH \$PH L$hH |$PH t$XH T$`H L$xH \$pH t$hL D$PL L$XH T$xH \$pH L$`H |$hH t$PL D$XI t$hH |$ H t$(L D$0L |$ H t$(L D$0L |$0f T$0H |$ H t$(L D$0L L$8f |$ H t$(L D$0L v,UH D$0H L$8H D$xH \$8H L$8H 8P-52 \$xH L$@H |$8H \$xH t$0L D$(H D$XH L$@H D$(H \$XH t$0H L$xH |$PH D$HH L$hH D$xH T$xI \$hH L$HH D$`H D$pH D$`H |$0f L$0L |$ H |$ H |$8H T$8H \$0H L$(H T$0H T$(H |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$pH D$xH D$hH \$PH L$hH |$PH t$XH T$`H L$xH \$pH t$hL D$PL L$XH T$xH \$pH L$`H |$hH t$PL D$XI |$8H T$8H \$0H L$(H T$0H T$(H |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$pH D$xH D$hH \$PH L$hH |$PH t$XH T$`H L$xH \$pH t$hL D$PL L$XH T$xH \$pH L$`H |$hH t$PL D$XI t$hH |$ H t$(L D$0L |$ H t$(L D$0L |$0f T$0H |$ H t$(L D$0L L$8f |$ H t$(L D$0L v,UH D$0H L$8H D$xH \$8H L$8H 8P-52 \$xH L$@H |$8H \$xH t$0L D$(H D$XH L$@H D$(H \$XH t$0H L$xH |$PH D$HH L$hH D$xH T$xI \$hH L$HH D$`H D$pH D$`H |$0f L$0L |$ H |$ H |$8H T$8H \$0H L$(H T$0H T$(H |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$pH D$xH D$hH \$PH L$hH |$PH t$XH T$`H L$xH \$pH t$hL D$PL L$XH T$xH \$pH L$`H |$hH t$PL D$XI L$PH D$pH |$PH D$hH \$`H L$XH d$hM T$`H T$XH D$xH T$xH L$pH |$PH |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L L$PH D$pH |$PH D$hH \$`H L$XH d$hM T$`H T$XH D$xH T$xH L$pH |$PH |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L L$PH D$pH |$PH D$hH \$`H L$XH d$hM T$`H T$XH D$xH T$xH L$pH |$PH |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L L$PH D$pH |$PH D$hH \$`H L$XH d$hM T$`H T$XH D$xH T$xH L$pH |$PH |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L L$ H L$(H ywy@ L$0H L$8H |$ D XfffffffH L$ H ffffffffH L$(H L$0H L$8H |$XD |$`D |$pD L$XH L$XH |$8D |$HH |$(H |$pD |$xD L$pH D$pH |$HD |$PD |$`H |$ D |$(D |$8H @ H! C H! L$ H T$8H T$(H T$0H D$8H D$(H D$0H D$ H D$PH D$XH L$ H T$@H T$(H T$8H T$0H D$@H D$(H D$8H D$ H D$0H D$`H D$(H D$XH D$PH T$8H T$ H T$0H T$(H D$8H D$ H D$0H D$(H D$XH D$ H D$PH D$0H D$0H T$0H |$8L D$0H D$hH T$PH D$hH D$HH \$PH T$hH T$@H 5ZuN |$pL |$PH |$ D |$0H T$hH T$HH T$@H D$hH |$ H |$@D |$HD |$XD |$hD |$pD |$ D D$@H D$hH t$@H T$hH |$@D |$HD |$XD |$hD |$pD |$ D D$@H D$hH T$@H T$hH |$@D |$HD |$XD |$hD |$pD |$ D D$@H D$hH t$@H T$hH |$@D |$HD |$XD |$hD |$pD |$ D D$@H D$hH T$@H T$hH |$@D |$HD |$XD |$ D |$0D |$hD |$pD D$@H D$hH D$hH \$@H \$@H \$hH D$pD |$@D |$HD |$ D |$0H D$pH T$hH T$xH D$hH S L! q H! S(L! q(H! S0L! q0H! S8L! q8H! S@L! q@H! SHL! qHH! SPL! qPH! SXL! qXH! S`L! q`H! ShL! qhH! SpI! IpH! D$`H |$(D |$0D |$@H L$`H T$hH T$ H |$`L L$ M! GXM! G`M! GhM! P H! wpL! vRUH D$HD D$HH D$HH \$pH @t0H D$hH |$(D |$8H \$pH T$pH T$PH T$ H D$HH D$HH D$hH D$h1 \$PH }TH D$HD |$(H D$HH D$HH D$HH \$(H D$ H D$ 1 \$xH ufD |$ D |$0D |$@D |$PH T$ H9 t$?H vLUH \$HD D$HH |$ H |$0D |$@D |$PD |$`1 T$XH D$`L T$ H D$(H T$0H D$@H T$xH T$hH D$pH \$@I \$0L L$XL T$pM T$hL d$xL |$`M T$HH D$PL D$8L |$8H |$PL L$HM \$(L d$ M) D$HH T$0I D$(L L$(H T$0H) T$ I T$ I) T$HH T$xH T$hH D$pH T$XH D$`H T$PH T$(H D$0H D$ H |$PL T$`L T$XL \$pM \$hL |$xM) T$@H D$HL D$8L \$8H L$HH \$@L T$ L |$0M d$(M) |$ D |$XD L$PD T$HD \$@D d$0D T$0H T$@H T$HH T$PH L$XH T$`H T$hH T$pH T$xH T$ H T$(H T$8H v3UH D$xD v3UH D$@H T$'L 5X5N T$'H \$HH t$(H vcUH |$(H 5*4N |$(H D$ H }%H D$ Hi D$(H D$0H D$(H D$ H L$ H L$ I \$0I L$(H L$(I t$ I vIUH D$(H L$ H =WrP D$(H T$0H vdUH D$0H v&UH CASTH .mc aB1H @u.H |$@D |$PD |$`D |$pH \$@1 |$ D |$0H rRH \$PH tyH \$(H D$0H L$(H T$0I D$HH D$HH D$H1 |$ f |$gD |$wH |$GD |$WH |$'D |$7H \$ H L$(H |$0H t$8L D$@L L$HL T$PL \$ H L$(H |$0H t$8L D$@L L$HL T$PL \$pH D$hH L$xH D$hH \$pH L$xH |$ H t$(L D$0L |$ H t$(L D$0L \$XH D$hH L$XH L$hI \$`H D$pH L$`H L$pI |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L D$xL \$XH D$`H L$XH =u`P L$`I D$xH |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L |$OD |$_D |$oD \$O1 |$/D |$?H =3[P \$ H L$(H |$0H t$8L D$@L L$HL T$PL \$ H L$(H |$0H t$8L D$@L L$HL T$PL =gYP =pXP D$0H D$(H D$ H L$ H L$ I \$0I L$(H L$(I t$ I vIUH D$(H L$ H =7VP D$(H T$0H vdUH D$0H v&UH L$HH L$PH L$XH L$`H L$hH L$pH L$xH #g9. a!;H #e$i 0@2H D$@H D$8f \$@H L$8I \$@H =MPP L$0I \$@H L$(I \$@H =3OP L$(I \$@H L$(I \$@H L$(I \$@H L$(I \$@H L$(I \$@H =zLP L$(I \$@H L$(I \$@H =dKP L$(I \$@H T$(I \$@H D$ f \$@H L$ H L$ I T$@I lP`H l')H {/vPH F75H 8/#+H T$(H T$0H T$8H T$@H T$HH T$PH T$XH T$`H T$hH T$pH T$xH sL@S T$(H T$0H T$8H ?JdH T$@H R=lH T$HH T$PH T$XH T$`H 9HR,H T$hH T$pH T$xH W[>K 8h]` T$(H T$0H AMSGmH T$8H T$@H T$HH T$PH T$XH i9'H T$`H T$hH T$pH :{37H T$xH Q'i4H op( w.eH ba9H *[P_ Ho;K=S dBk? D$@L D$hH t$`H |$XH L$PH \$HH L$PH SHA-u f SHA- SHA- SHA-u f SHA- SHA- SHA3-224H9 SHA3-256H9 SHA3-384H9 SHA3-512H9 \$HH SHA-512/L9 4t0L9 L$PH \$HH D$@H |$XH t$`L |$ H t$(L |$ H t$(L vOUH \$HH |$XH |$ H t$(L |$ H t$(L \$XH t$pH |$hH D$PH D$PH t$pH |$hL T$0H L$ L D$(H L$ f T$pL D$8H D$0M9 D$8H T$pH \$ H \$hL9 D$8H L$ H |$ H t$(L |$ H t$(L D$XL t$xH |$pH L$hH \$`H L$hH SHA-u f SHA- SHA- SHA-u f SHA- SHA- SHA3-224H9 SHA3-256H9 SHA3-384H9 SHA3-512H9 \$`H SHA-512/L9 4t.L9 L$hH \$`H D$XH |$pH t$xL |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L D$PL D$xH t$pH |$hH L$`H D$PH D$8H \$0H D$PH \$XH L$`H |$hH t$pL L$0H9 |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L |$hL \$XL D$xH t$pH D$PH D$81 D$8H t$XH9 L$ H \$0H T$(H L$hH L$hH D$pH \$xH L$hH D$pH L$hH D$pH \$0H |$(H T$PH t$XH |$ E1 \$8D |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$HH \$`H T$`H |$HH) T$xH |$hL D$pH L$xH L$@H L$`H T$pH) L$XH T$hH! |$XH T$hH t$@f d$xC |$`L L$XH \$PH L$XH T$hH \$PH t$`L L$`H |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L D$XH \$xH T$hL L$GL L$`L L$hf D$GA! D$ H T$xI) L$hH D$XI9 L$hH |$pH D$xI D$HL) L$PH |$PH \$ H L$(H |$0H t$8L D$@L L$HL \$ H L$(H |$0H t$8L D$@L L$HL \$0H L$8H L$8H \$0H =N!P L$0H L$0H O.sNu D$hH t$hL \$PH D$XL D$HH L$HH T$PH D$`L D$`H L$HH |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L D$pL \$xH D$xH O.sNu D$pH L$PH L$PI T$xH T$hH L$ H |$(H t$0L D$8L L$@L T$HL L$ H |$(H t$0L D$8L L$@L T$HL D$8H D$XH \$`H D$0H D$pH \$xH D$(H D$@H T$@I |$0H t$(H D$8H \$@H L$HH |$PH t$XL D$`L D$8H \$@H L$HH |$PH t$XL D$`L |$`f D$`L \$PH L$XH \$PH \$@H L$HH \$@H L$HH \$@H L$HH \$@H \$0H L$8H |$0H t$8L L$PH L$XH L$@H L$HH |$ H |$ H D$HH D$pH \$xH D$@H D$0H D$XH T$XI D$PH D$XH T$XI D$(H L$HH T$PH \$@H t$0H L$(f L$HI T$PI \$@I t$0I L$(M D$8H D$81 D$XH |$pL D$0H D$@H T$@f T$@I \$xH D$8H L$0H L$0I T$8I D$(H L$pH D$(1 |$ H t$(L D$0L |$ H t$(L D$0L |$XH |$XH |$PH |$PI L$@L T$0L t$@H |$0L t$@H |$0L T$HL T$HI d$8L l$(L L$(L T$8L L$(L T$8H T$0H T$@H T$(H T$8H L$PH L$PH L$PH9 L$PH L$XH T$XH L$HH L$HH L$HH9 L$HH L$XH T$XH L$XH T$XH \$@H \$@H L$@H9 L$@H L$XH T$XH |$XH |$XH |$XH \$8L \$8H L$8H9 L$8H L$XH T$XH L$XH T$XH L$XH T$XH \$(H \$(H L$(H9 L$(H |$`f t$`H L$XH T$XH \$0H \$0H L$0H9 L$0H D$hH T$HH T$PH T$XH T$`H |$ f D$ L vhUH |$HH L$@H D$0H D$0H \$8H L$@H |$(H T$(H T$@H \$8L \$8H L$8H9 L$8H |$HH t$HH \$0H \$0H L$0H9 L$0H L$@H |$ @ v&UH |$xD D${[ D$|Qm+ vfUH L$pL D$`H \$hL T$`H D$PL L$XL \$hH \$ H L$(H |$0H t$8L D$@L L$HL T$PL \$ H L$(H |$0H t$8L D$@L L$HL T$PL D$pH t$pH L$@L D$8H t$XH t$`H |$HH \$hL D$PD L$/L T$XL \$@L d$8H L$hL T$HH9 D$PL L$hH T$@H \$8H t$XD \$/A D$`H \$8L D$PL L$hL T$HH) L$0H T$`H T$`H D$`H \$h1 |$0H9 L$PH D$hH \$HH T$8L L$@M9 |$0H D$XL T$8H |$0H |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$pH D$HH \$PH |$`H t$hH L$XH L$xL D$HH L$XH \$PH t$hH |$`L D$pL L$xL T$HH D$(H \$PL L$(M D$HH \$XH L$`H D$01 |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$pH t$pH L$@L D$8H t$XH t$`H |$HH \$hL D$PD L$/L T$XL \$@L d$8H L$hL T$HH9 D$PL L$hH T$@H \$8H t$XD \$/A D$`H \$8L D$PL L$hL T$HH) L$0H T$`H T$`H D$`H \$h1 |$0H9 L$PH D$hH \$HH T$8L L$@M9 |$0H D$XL T$8H |$0H |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$pH D$HH \$PH |$`H t$hH L$XH L$xL D$HH L$XH \$PH t$hH |$`L D$pL L$xL T$HH D$(H \$PL L$(M D$HH \$XH L$`H D$01 |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L v&UH t$ H t$ H D|8A s-I t$ H t$ H L|8D T|:A t$ H t$ H L\8D T\:D \\A |$'H t$ H t$ H $CI! LD i LD H t$ f t$ H $CI! ,RE) T$?H |$@H |$&D DL@H TL@H t$@H t$@H Q H9 \$@H @t0H D$8H T$8H T$ H D$81 vOUH D$HH \$PD |$(H D$PH \$HH |$8H D$8H D$81 rkH L$0H L$0H |$ H t$(L |$ H t$(L v[UH \$(H D$0H !"#$%&'(H )*+,-./0H 12345678H 9:;<=>?@H ABCDEFGHH IJKLMNOPH QRSTUVWXH YZ[\]^_`H R;t_AH y729m D$ H t$ H t$ H LD8D TD:A v&UH D$pH \$xH T$pH \$PH L$HH D$XH T$PH T$HH L$XI L$pH D$pH T$pH \$PH L$HH D$XH T$PH T$HH L$XI L$pH D$pH \$XH L$`H D$hH \$xH T$hH D$x1 L$pH |$XH t$`L |$ H t$(L D$0L |$ H t$(L D$0L T$hH T$pH x quR T$HH t.ICH T$PH T$XH T$`H T$xH T$hL \$xI D$pH \$`H L$XH T$hH t$pH t$`H t$XH \$xH |$ H t$(L D$0L L$8L T$@L |$ H t$(L D$0L L$8L T$@L T$pL L$hH L$hH tls1f S H9 L$hH D$xH T$`H \$`H L$hH9 \$`H \$`H D$xH T$`H D$@H \$xH D$ H \$(H L$0H |$8H t$@L D$HL L$PL D$ H \$(H L$0H |$8H t$@L D$HL L$PL L$hL D$XH \$`H T$XH D$@H \$`L |$@H D$XH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L D$pH \$xH \$HH L$@H D$XH T$HH T$@H L$XI D$PH L$xH T$pH L$xI T$pI \$PH |$ H |$ H v-UH L$hL D$XH \$`H T$XH D$@H \$`L |$@H D$XH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L v&UH L$pH L$xH L$@H L$HH L$PH L$XH L$`H L$hH D$pI D$pH \$xH T$pH ;u%H O.sNu>H D$XH .t-H T$pH T$pH \$xH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L \$XH L$XH9 D$hH D$`H t$hH t$XH D$`H D$ H \$(H L$0H |$8H t$@L D$HL L$PL D$ H \$(H L$0H |$8H t$@L D$HL L$PL D$PH \$xH D$P1 L$HH T$(H) L$HH \$PH t$`H L$`H L$@H) L$0H |$8H D$P1 T$@H t$`H |$HH L$8H \$0H D$XH |$HH T$@H t$`H L$PH \$XH |$8H L$PH \$xH D$P1 L$@H9 T$(H \$`H9 D$ H \$(H L$0H |$8H t$@L D$HL L$PL D$ H \$(H L$0H |$8H t$@L D$HL L$PL D$xH ;u.H T$xH O.sNuMH D$XH \$`H T$xH .t2H T$xH D$XH T$xH |$ H t$(L D$0L L$8L |$ H t$(L D$0L L$8L \$XH L$XH9 D$hH D$`H t$hH t$XH D$`H D$ H \$(H L$0H |$8H t$@L D$HL L$PL D$ H \$(H L$0H |$8H t$@L D$HL L$PL D$PH \$xH D$P1 L$HH T$(H) L$HH \$PH t$`H L$`H L$@H) L$0H |$8H D$P1 T$@H t$`H |$HH L$8H \$0H D$XH |$HH T$@H t$`H L$PH \$XH |$8H L$PH \$xH D$P1 L$@H9 T$(H \$`H9 D$ H \$(H L$0H |$8H t$@L D$HL L$PL D$ H \$(H L$0H |$8H t$@L D$HL L$PL D$pH \$xH \$HH L$@H D$XH T$HH T$@H =WuO L$XI D$PH L$xH T$pH L$xI T$pI \$PH |$ H |$ H vnUH ckx Load Swap isV6 conn nbuf bufp sync next prev Done elem ctrl done stop once errs Read free peek Flag fmtC fmtQ fmtS init plus zero prec Scan typ_ flag Name Addr Size Mask To16 Port Zone File dial name conn Idle wait wrMu read Type Text file path sort Host addr Conn Dial Lock size Once stat data text Data wbuf Push Stop Join Body Path wild host Form bits cond lock werr bufr bufw logf take flow Code date Init Wait body mask rerr code resp find tree push head Less root treq tail hbuf henc Ping zerr keys Seek Stat Open pipe Keys iter Head Post send mode Mode file Sync seek refs info Info File Kill kill want Func Grow grow Zero Attr Nano Unix Nsec Usec Bits Base Rdev Atim Mtim Ctim Unit Time Ctty Pgid Line time when zone Date Hour Year mono nsec wall kind byte pool auth iaid Bool Span port Dist Tags user tags Next node swap dead seed span last base Elem Kind Type pack vals sema wrCh rdCh pipe Call Recv Send Seq2 Uint call recv ireg freg ftyp rcvr dump abid walk weak As16 Prev *int heap link pad1 pad2 nfns ftab ebss ptab args pcsp pcln flag diff goid gopc argp ctxt bitp list tiny load scav node nobj get1 get2 runq rank curg oldp ncgo park line wake skip tick rrun wrun rseq wseq self hash ones full deps fill emit AAAA Perm fdmu dups cert scts leaf Leaf Conn Rand rand Seal aead quic vers hand User Sort Peek bool Seed feed Intn ents Wire Back move cidr Hash Mtyp Moff Dump Ints Ptrs step scan More Find With Main Deps Inst Inst expr prog inst jobs Copy Time Sign byWd core Logf Logw Warn Core subs Fire Exit open with Core hook Free IsCA URIs Cert eval GOOS used Used seen ECDH Qinv fips ivlo ivhi seal ecdh hist rBuf dict freq good lazy nice divW itoa make modW norm sqrt utoa Sqrt form tccc rune nsrc Href Desc Expr Rune Sub0 sign Args NArg Qoss Decl argv copy pDst pSrc nDst nSrc ISO3 lang qInv trim opad ipad rate keyX strX numX fake nest locs deck pExt htab cell Value value Store slots cause timer Error Inter Token Width write limit count atEOF error token Write fmtBs fmtBx fmtQc fmtSx minus sharp space plusV Equal Close laddr raddr Count close Addrs Index Flags Scope Label mtime ndots error addrs first Mutex RLock index valid Valid Flush Reset state group Clone Proto multi HTTP1 HTTP2 flush serve Serve avail check IsAck Cause vlogf donec match hosts Limit empty shift bytes proxy extra trace reqch reqMu altMu Proxy abort on100 tconn pings State conns isDir Timer start IsDir Chdir Chmod Chown chmod pread sigMu clear Round trunc table build Halen Level Start Utime Stime Ixrss Idrss Isrss Nswap Nvcsw Nlink flags stack PidFD Hours split clock isDST isstd isutc After Clock IsDST Local Month Touch agent watch mutex spans Debug Bytes level Clear cache items event scope entry Range lines Align NumIn IsNil local Field Float Slice runes ptrTo steps iregs fregs spill Unmap v6u16 *int8 *uint *bool magic minLC nfunc vaddr cutab pctab minpc maxpc etext edata gcbss types datap _Func _func Entry Unpin unpin equal retpc bytep alloc inUse store gList total hchan reset sendx recvx recvq sendq swept stamp wbuf1 wbuf2 gFree wbBuf valPC nextp locks dying incgo sched param sigpc union merge rNext array timer sleep fdseq ready chain Frees reuse Stack Alloc GCSys NumGC Class io/fs rsema wsema Sysfd csema Fstat Fsync Pread evict chans Extra useBy Suite input nonce label clone ecdhe mlkem KDFID KemID kdfID inner isRSA SetIV ivLen curve hello suite Fatal Panic Print outMu IsAbs Parse Query bufio Split int64 Int63 Int31 code_ Front Size_ TFlag Kind_ Group Int64 scanp Match Mount Patch Route Trace mpool dense atEOT Infof Infow Logln Named Warnf Warnw logln Check Sugar apply Build Topic topic Order getID Hooks LogFn AddTo Entry dirty after cores elems funcs Coeff Merge quiet dedup Curve block child Empty Curve links wrPos rdPos final codes nbits expNN expWW nLead _byte isMax nbyte nrune Rune0 class Usage NFlag Visit failf usage undef AddIP ncopy Names Flags Stdin isMid title lower bases m0inv IsOdd IsOne limbs outer is224 field typeX unitX fileX nameX Prune Scale width unique zoneV6 status String cancel` errors Unwrap reader accept fmtSbx sharpV intbuf Format family opAddr Source sotype Enable Server Accept Listen unlink PollFD Weight negate action source Prefix search rotate lookup useTCP server Cancel dialIP Dialer Unlock byName update recent bisect IsZero Header Length Framer stream values Values Status Quoted Domain MaxAge Secure method Method Cookie setBit inRead remain unlock header Hijack curReq unsent framer inflow serveG Fields scheme parent goAway unread readFn skipWS Reader closed condfn sawEOF multis handle mux121 Handle onlyH1 nwrite idleAt broken reused addTLS result remove idleMu isHead chunks Writer Reason Closer length ReadAt pwrite decref incref Signal rusage Exited exited signal Remove finder prefix oldnew Family Groups Hatype ZoneId SetLen HostID Events Maxrss Minflt Majflt Msgsnd Msgrcv Nivcsw Blocks Offset Chroot Ptrace Setsid Noctty active Layout format offset extend Before Minute Second absSec addSec locabs setLoc`lJ Router reload apiKey client frames GetKey Frozen record Parent Sample Finish SetTag sample Buffer buffer limits worker Client inited initMu Delete expand common Common NumOut CanSet unpack shared noCopy victim notify doSlow Lookup mustBe CanInt SetCap SetInt Slice3 CanSeq stkOff append addArg argLen fields isZero BitLen Is4In6 addOne halves subOne *error *uint8 *int16 *int32 *int64 *[]int unsafe opaque nfiles ptrbit gcdata etypes rodata gofunc funcID pcfile pinner signed goexit insert noscan npages nelems divMul inList isFree layout refill allocN timers waiter adjust siftUp verify astate isChan isFake period modify trace1 qcount ticket tryGet mcache pcache palloc cycles lenPos varint divmod procid vdsoSP vdsoPC _panic _defer labels counts inHeap ensure scalar fileID wakeup parked Cycles NextGC LastGC BySize writer nextPC string@ Unpack Header Answer rwlock iovecs isFile Fchdir Fchmod Fchown Pwrite Writev Shared DoChan doCall@^P secret ageAdd events config Config aesKey keyLen incSeq cipher didHRR random cookie AEADID aeadID params Double Params macLen` encode strict Strict Decode Encode HW Fatalf Output Panicf Printf Writer output Scheme Opaque tmpoff Buffer digest Uint16 Uint32 Uint64 uint64 Int31n Int63n int31n Reused dynTab Stride excess@ Config Align_ GCData HasTag Mcount Xcount Floats Struct quoted endTop object opcode Routes isLeaf routes inline Logger suffix tokens regexp NumCap sparse inputs Expand@ Verify leeway Claims Errors byPath shared DPanic Debugf Debugw Errorf Errorw Fatalw Infoln Panicw Warnln ~r Result opened Dialer freeID obound connMu resume` Levels InfoFn Tracef WarnFn Caller Xk AddInt Equals Should spaced addKey Issuer Detail domain parsed Import gopath GOARCH GOROOT GOPATH groups rehash dirPtr dirLen` Arenas Init64 Refill Reseed enable crypto Public Primes NewGCM rounds bitLen seqNum boring toRead nbytes window andNot isPow2 sticky AndNot Append CmpAbs DivMod QuoRem SetBit isYesC isYesD hangul Reader runeAt asciiF flushF expvar MaxCap concat factor repeat numCap height Period IntVar Parsed actual formal` Retain Topics bypass go/ast Select Broken Stderr Stdout cccVal langID IsRoot Region Script region script locale Subtag BytesX bytesX Export SubOne assign cmpGeq Toggle dsbyte Invert Mult32 Negate Square reduce labelX ScaleN@ pbLine int64s tryAdd LangID gobble fromP2 write0 writeN widths@ reqBody written dateBuf clenBuf *func() context Context Timeout pending consume *fmt.pp badVerb doPrint fmt0x64 fmtBool reflect Network toLocal *net.IP WriteTo connect readMsg setAddr writeTo TCPConn Control rawConn Compare IsValid srcAttr sources sa_data ai_addr ai_next servers timeout soffset trustAD primary dialTCP dialUDP network address TryLock RLocker RUnlock RWMutex Consume readBuf Trailer Request Expires Cookies GetBody Pattern matches Context Referer hasByte byteBuf aborted Handler newConn handler baseCtx streams ErrCode Setting trailer didRead closing pattern control Request writech closech isProxy tlsHost waiting headPos idleLRU DialTLS getConn dialTLS bufPipe readErr dialing Payload Readdir ReadDir *http.I modTime ModTime dirinfo WriteAt readdir wrapErr Syscall Success success Release pidWait release strconv strings Replace mapping syscall Ifindex Pkttype Stopped Address Inblock Oublock X__pad0 Blksize Version version Setpgid Setctty Options Message Minutes Seconds AddDate ISOWeek Weekday YearDay setMono unixSec maxIdle Current oldPath watcher Publish IsEmpty GetTags GetType GetUnit isValid Entries GetHost GetPath GetPort EventID options Recover CaCerts SetData toEvent request SetTags SetUser modules envTags started isEntry keyHash Float64 PkgPath ChanDir GcSlice HasName MapType nameOff typeOff *[]int8 pointer popHead popTail private getSlow pinSlow checker writers readers CanAddr CanUint Complex Convert MapKeys Pointer SetBool SetUint SetZero TryRecv TrySend abiType CanSeq2 textOff addRcvr PtrType regPtrs *[1]int AsSlice hasZone string4 string6 *string runtime *uint16 *uint32 *uint64 *[]uint *[]bool ptrSize funcoff filetab covctrs hasmain typemap srcFunc npcdata startPC startSP isEmpty takeAll objBase pushAll running zombies raceCtx addHeap blocked dequeue enqueue sortkey waiters nextSeq inSweep balance dispose putFast pushcnt discard runnext preempt destroy seqlock entries morebuf gsignal sigmask isextra alllink lockedg libcall chacha8 lockedm startpc racectx cgoCtxt coroarg buckets compute ensured gcStats hdrsize stackID makeArg padding counter Mallocs Lookups HeapSys PauseNs DebugGC callers answers section setting DNSDone SysFile RawRead ReadMsg prepare signalc cancelc readbuf session hmacKey created RootCAs decrypt encrypt nextMac curveID sendBuf marshal NetConn newCert nSecret keySize padChar Fatalln Panicln Println net/url setPath RawPath tempDir content tmpfile Discard Comment seedPos readVal readPos Float32 Shuffle WasIdle GetConn GotConn compose codeLen maxSize minSize saveBuf unicode NoProxy InCount IsBlank Methods InSlice KeySize ptrSeen encoder elemEnc elseEnc scanned getEdge Connect NoColor onepass longest matched visited FindAll Longest doMatch bufsize AddWith recurse watches cookies onPanic onFatal DPanicf DPanicw Debugln Desugar Errorln Enabled newSink payload Servers WillQos SetWill claimID cleanUp oboundP persist workers backoff Disable AddHook DebugFn ErrorFn FatalFn PanicFn PrintFn TraceFn Traceln Warning resolve Matches Defined AddBool AddInt8 AddTime AddUint Integer OnWrite AddCore resetAt Subject getCert haveSum AddCert hintErr parents hasData SrcDirs readDir saveCgo PutSlot writing Feature LoopVar Package Changed verbose Decrypt nMinus2 BitSize Inverse Encrypt tagSize subkeys cipher1 cipher2 cipher3 suiteID context AddASN1 Unwrite Headers roffset copyLen huffSym literal deflate codegen ndigits setWord IsInt64 ModSqrt SetBits expSlow LeadCCC isInert bytesAt doFlush setDone skipNop repeats storage BoolVar TextVar UintVar sprintf Acquire Details AddHost AddZone forward NetDial scratch Country os/exec skipped sys~ Process Environ environ cccType isBreak isCased copyXOR retSpan rewrite IsGroup Regions Scripts scripts regions newHMAC readLen shiftIn forHKDF permute decoder BuildID Mapping NumUnit buildID nextAll freeStk pbLabel boolOpt uint64s replace toLower addLine endChar go.shape net/http trailers *[]uint8 Deadline children deadline emptyCtx ReadRune *fmt.fmt fmtFloat truncate fmtFlags erroring wrapErrs doPrintf fmtBytes printArg GoString sockaddr appendTo AddrPort addrFunc readFrom shutdown writeMsg ReadFrom Interval Contains AppendTo Priority addrAttr criteria ai_flags attempts noReload nameList PreferGo LookupIP LookupMX LookupNS exchange lookupIP lookupMX lookupNS preferGo resolver Resolver dialUnix initOnce TryRLock readLine PusherID DataSize StreamID logReads endWrite logWrite NewTimer HttpOnly SameSite Unparsed Location segments PostForm Response FormFile patIndex SetHTTP1 SetHTTP2 chunking tlsState curState getState hijacked setState ErrorLog ServeTLS Shutdown Settings newTimer readMore streamID inGoAway pingSent condlogf breakErr closeErr isPushed WriterTo didClose onHitEOF addChild eachPair register MarkDead setError cacheKey canceled isBroken isReused readLoop proxyURL popFront pushBack idleConn altProto dialConn ConnPool connPool abortErr lastIdle expected Listener Username Password *os.File *os.file nonblock Truncate ExitCode SysUsage UserTime sysUsage userTime OpenFile priority ReadByte prevRune contains Protocol Flowinfo Scope_id CoreDump Signaled Nsignals CgroupFD cacheEnd UnixNano lastUsed needUser doneChan watchDir stopChan LogLevel PoolSize IAIDPath Filename IsFrozen recorder contexts MaxSpans doFinish Overflow SetExtra SetLevel overflow groww category disabled PopScope stackTop indirect valEqual initSlow go/token uncommon FuncType NumField Pointers Uncommon *[]int16 *[]int32 *[]int64 assignTo pushHead headTail *io.pipe CanFloat MapIndex MapRange SetBytes SetFloat setRunes typeSlow cloneSeq find init iter WithZone *uintptr *float32 *float64 *[]error cuOffset entryoff baseaddr bytedata pcHeader noptrbss ecovctrs funcName textAddr funcInfo entryOff FileLine Function refStore subtract lessThan slotsPtr stktopsp sweepgen needzero elemsize specials heapBits objIndex flushGen nextFree scavenge push raceaddr initHeap siftDown wakeTime sendLock maybeAdd needsAdd dataqsiz synctest elemtype isSelect waitlink waittail maySweep putBatch runqhead runqtail sudogbuf statsSeq waitTime lastTime varintAt targetpc waitsema lockAddr mstartfn throwing spinning freeWait ncgocall waitlock freelink libcallg dlogPerM coroexit tracking writebuf sigcode0 sigcode1 guintptr released inStacks mSpanSys otherSys heapGoal IdleTime cpuStats heapScan sysStats cpuStats tagCount concrete asserted dispatch callingG capacity HeapIdle StackSys MSpanSys OtherSys PauseEnd EnableGC position fileLine realType Question resource fileInfo DNSStart rwunlock *poll.FD IsStream RawWrite WriteMsg eofError readLock pollable waitRead isClient eventArr blockedc Overhead haveVers rawInput lifetime original pskModes ConfigID response newPoint SetFlags *url.URL Hostname JoinPath Redacted username password OmitHost RawQuery Fragment NextPart ReadForm nextPart readForm FileName FormName closeDot ReadLine Buffered lastByte writeBuf lastRead IsPseudo addEntry callEmit checkEnd PushBack lazyInit useProxy PtrBytes OutCount Embedded OutSlice ptrLevel omitZero scanNext arrayEnc Endpoint URLParam Handlers *chi.Mux findEdge tailSort NotFound useColor encoding matchcap newBytes mono nsec Validate timeFunc noFollow isClosed doneResp newEvent addStack DPanicln WithLazy openFile ReadJSON read complete Retained retained messages ClientID SetStore AddRoute getToken addRoute lastSent outbound callback ExitFunc GetLevel Warningf WithTime newEntry FieldMap TypeName FullPath AddArray AddInt16 AddInt32 AddInt64 AddUint8 hashFunc isRSAPSS NotAfter KeyUsage DNSNames Policies Subjects hintCert validate hasValue go/build importGo joinPath matchTag Compiler ToolTags lockSlow clearSeq *sys.nih SwissMap Synctest HashFunc *aes.CTR *gcm.GCM checkSum constSum AddBytes AddValue SetError Exporter generate linkMask *[19]int histSize codebits copyDist copyData moreBits encSpeed bitCount matchLen hashHead hashPrev Generate math/big *big.Int *big.nat divBasic divLarge mulAddWW mulRange setBytes subMod2N Binomial IsUint64 MulRange SetInt64 TrailCCC IsNormal doAppend multiSeg nextMain tmpBytes CapNames Simplify capNames calcSize collapse parseInt tmpClass numRunes DefValue BoolFunc Duration Int64Var VisitAll parseOne WillFlag isServer writeErr compress optional explicit timeType Locality Province HasValue Comments baseline watchCtx firstErr isLetter caseType scriptID regionID Variants language resetFor Required Absolute Multiply Pow22523 Subtract buildIDX fileName IsFolded isFolded NumLabel commentX Demangle LabelSet nextHash pbSample int64Opt Maximize minimize RegionID ScriptID pVariant minwidth tabwidth padbytes net/netip *[3]uint8 cancelCtx statusBuf cancelCtx Temporary AfterFunc *[4]uint8 writeByte writeRune Precision padString reordered panicking argNumber badArgNum doPrintln fmtString *net.Addr IsPrivate *net.conn LocalAddr closeRead CloseRead SetLinger noWriteTo *net.Conn UnwrapErr IsTimeout ReadMsgIP WriteToIP KeepAlive AcceptTCP sa_family ai_family *[2]uint8 *[]net.IP *chan int partition LookupSRV LookupTXT lookupSRV lookupTXT dualStack DualStack dialMPTCP doDialTCP *net.file *[]string StreamDep Exclusive isControl *[9]uint8 dataFrame lastFrame errDetail headerBuf logWrites *[8]uint8 PromiseID ReadFrame WriteData WritePing connError CloseConn closeBody AddCookie BasicAuth FormValue ParseForm PathValue UserAgent ServeHTTP *[1]uint8 hijackedv *[]func() TLSConfig ConnState Protocols listeners protocols trackConn ServeConn afterFunc serveConn Available available idleTimer Truncated debugData DebugData Increment endStream newStream notePanic startPush setBuffer bodyBytes writeBody boundAddr BoundAddr findChild matchPath queuePool RoundTrip addedGzip readLimit roundTrip writeLoop proxyAuth afterDial peekFront closeIdle AllowHTTP timeSince reqCancel abortOnce firstByte doRequest singleUse readerErr closeConn idleState setGoAway closeOnce transport Transport pathAddrs ProxyDial *[5]uint8 pidSignal pidStatus pidfdWait os/signal *[256]int tableSize toReplace WriteByte WriteRune copyCheck buildOnce Continued TrapCause *[2]int32 Interface *[3]int64 X__unused *[0]uint8 Pdeathsig ValueElem cacheZone GobDecode GobEncode UnixMicro UnixMilli stripMono initTimer sendError GetIssuer startTime ReloadNow SentryDSN BrokerURL brokerURL waiterSem *[7]uint8 publicKey secretKey projectID GetAPIURL GetScheme Configure SendEvent SetupOnce HTTPProxy ToBaggage RemoveTag SetExtras ReadBytes emptyw processor SetClient PushScope WithScope StoreNoWB ArrayType NumMethod writerSem readerSem localSize Broadcast *sync.Map Anonymous CallSlice SetString bytesSlow regAssign retOffset stackPtrs inRegPtrs framePool SliceType appendTo4 appendTo6 *[]uint16 *[]uint32 *[]uint64 rangefunc textStart NotInHeap pclntable noptrdata enoptrbss typelinks itablinks pkghashes inittasks gcbssmask startLine isInlined nfuncdata lessEqual recovered nextDefer nextFrame schedtick schedwhen sizeclass startAddr freeindex allocBits spanclass largeType scanAlloc empty decActive incActive syncGroup cleanHead deleteMin isSending reclaimed deferpool goidcache haveStack reentered caughtsig mallocing profilehz printlock traceback schedlink lockedExt lockedInt mWaitList profStack libcallpc libcallsp cheaprand locksHeld syscallsp syscallpc syscallbp stackLock waitsince ancestors sleepWhen committed largeFree inObjects stacksSys mCacheSys gcMiscSys TotalTime stackScan totalScan heapStats dataCount sleepStub FreeBytes HeapAlloc HeapInuse MCacheSys questions AResource Authority IsRegular Ftruncate WaitWrite WriteOnce writeLock waitWrite *tls.Conn EarlyData createdAt nextEvent DidResume TLSUnique ClientCAs *tls.aead NonceSize didResume buffering bytesSent unmarshal sessionId keyShares earlyData PublicKey Handshake sendAlert signature clientMD5 serverMD5 clientSum serverSum BlockSize nonceMask IsOnCurve Unmarshal nonceSize handshake decodeMap SetOutput SetPrefix isDiscard bufReader partsRead tmpshared RemoveAll DotReader skipSpace ReadSlice readSlice PutUint16 PutUint32 PutUint64 math/rand Coalesced Sensitive idToIndex maxStrLen MoveAfter PushFront matchHost ProxyFunc httpProxy *abi.Kind *abi.Type PtrToThis *abi.Name *abi.ITab nameBytes omitEmpty readIndex saveError scanWhile useNumber UseNumber readValue SetIndent indentBuf parentCtx RoutePath URLParams SubRoutes *chi.node paramKeys subroutes endpoints FindRoute findRoute routeHTTP GoVersion MatchRune numSubexp prefixEnd newReader newString hasPrefix FindIndex NumSubexp backtrack doExecute doOnePass CurveBits verifyIat validator Signature WatchList xSupports sendEvent cookiesMu addCaller serveHTTP *zap.ints *zap.Sink openSinks factories WriteJSON write baseToken subResult messageID MessageID Duplicate duplicate WillTopic OnConnect AddBroker SetDialer UnsetWill Subscribe connected statusMap msgRouter optionsMu reconnect Formatter entryPool SetNoLock WarningFn Warningln WithError WithField HasCaller fireHooks sprintlnn isColored GetClient AppendInt AddBinary AddObject AddString AddUint16 AddUint32 AddUint64 NewTicker *x509.OID toASN1OID RawIssuer NotBefore lazyCerts CreateCRL Algorithm blockSize ImportDir MatchFile hasSubdir isAbsPath matchAuto matchFile BuildTags IsAbsPath HasSubdir *maps.Map Specified CgoCheck2 CacheProg RangeFunc seenLossy PublicKey nistCurve CRTValues **big.Int nextNonce baseNonce fixedSize AddUint24 AddUint48 *[316]int availRead readFlush writeCopy writeMark stepState dataBlock nextBlock fillStore findMatch storeHuff syncFlush freqcache bitCounts bitLength writeBits writeCode bestSpeed chainHead windowEnd hashMatch *big.Word setUint64 FillBytes SetUint64 lehmerGCD Transform copySlice setString skipASCII QuickSpan transform flushCopy insertCGJ backwards quickSpan composing StartCond alternate checkSize newRegexp numRegexp StringVar Uint64Var *[2]error TopicName Keepalive bypassIPs writePool isWriting readFinal frameType writeBufs temporary BitLength FullBytes *asn1.Tag IsKeyword IsLiteral suffixOff *exec.Cmd WaitDelay goroutine ctxResult StdinPipe isMidWord titleSpan IsCountry Extension isCompact ExpandFor marshaled outputLen initBlock SqrtRatio StartLine filenameX mappingID locations numlabels TimeNanos Aggregate Normalize preEncode pbMapping stringOpt uint64Opt stringMap HasString equalTags fromP1xP1 endEscape *[]*string *struct {} *[29]uint8 *[10]uint8 *chan bool wantsClose fullDuplex *[1]string *[32]uint8 UnreadRune *fmt.State clearflags fmtBoolean fmtInteger fmtUnicode *func(int) widPresent *[68]uint8 goodArgNum catchPanic fmtComplex fmtPointer missingArg printValue *[16]uint8 isWildcard AppendText IsLoopback RemoteAddr *net.netFD closeWrite CloseWrite SetNoDelay *net.IPNet noReadFrom IsNotFound ReadMsgUDP WriteToUDP ReadFromIP WriteMsgIP unlinkOnce AcceptUnix *net.Error *net.Flags *net.scope Precedence ai_addrlen *[][]uint8 unknownOpt forResolve LookupAddr LookupHost LookupPort goLookupIP goLookupMX goLookupNS lookupAddr lookupHost lookupPort tryOneName dialSerial dialSingle doSlow *[2]string *[12]uint8 *[4]uint64 *[15]uint8 checkValid invalidate writeDebug countError getReadBuf frameCache startWrite writeBytes writeFrame OpenStream CountError StatusCode ProtoMajor ProtoMinor RawExpires RequestURI WriteProxy *http.conn FlushError remoteAddr lastMethod finalFlush inShutdown activeConn onShutdown checkNotOn bodyReadCh serveMsgCh writeSched goAwayCode readFrames rejectConn runHandler shutDownIn wroteFrame reqTrailer snapHeader sentHeader wroteBytes writeChunk ReadCloser *http.body earlyClose readLocked BodyCloser IsResponse ByteReadCh doBodyCopy unwrapBody readCloser addPattern multiChild emptyChild handleFunc HandleFunc continueCh callerGone writeErrCh markReused targetAddr beforeDial tryDeliver peerClosed readClosed resTrailer readerDone doNotReuse lastActive sendGoAway promisedID SetCookies appendMode *os.Signal SystemTime systemTime *[3]uint32 *[2]uint64 *[24]uint8 *[65]uint8 UnreadByte *[108]int8 ExitStatus StopSignal *[8]uint32 Credential Foreground Cloneflags *[19]uint8 LayoutElem *time.zone *time.Time cacheStart lookupName Nanosecond ZoneBounds initTicker *[64]uint8 socketPath RPCHandler GetSubject Middleware GetSecrets readSecret SocketPath APIBaseURL initClient HasEntries sampleRate finishOnce sdkVersion SampleRate BeforeSend ServerName HTTPClient HTTPSProxy SetContext StartChild SetRequest ReadString contextify BufferSize BindClient breadcrumb Comparable Implements FieldAlign IfaceIndir StructType readerWait *[96]uint8 *sync.Pool victimSize *sync.Cond *sync.Once *io.Writer *io.Reader *io.Closer IsExported CanComplex CanConvert SetComplex SetIterKey SetPointer UnsafeAddr IsVariadic StructType assignIntN valueStart stackBytes outRegPtrs structType **abi.Type *[][]int32 expand string4In6 *[]uintptr *complex64 *[]float32 *[]float64 pclnOffset modulename enoptrdata pluginpath gcdatamask *runtime.g *runtime.m *runtime.p insertBack allocCache gcmarkBits pinnerBits allocCount countAlloc nextSample tinyoffset tinyAllocs stackcache allocLarge releaseAll updateHeap mSyscallID tryGetFast workbufhdr checkempty sysmontick sudogcache mspancache gcStopTime recordLock cyclesLost stringData goSigStack preemptoff isExtraInC needextram cgoCallers winsyscall preemptGen waitreason gcscandone throwsplit raceignore parentGoid selectDone difference inWorkBufs largeAlloc numObjects totalFreed totalFrees mSpanInUse accumulate GCIdleTime atomicInfo _interface *[4]uint32 *[8]uint64 sysmonWake sleepRatio shouldStop gomaxprocs InUseBytes AllocBytes TotalAlloc StackInuse MSpanInuse frameStore *[14]uint8 Additional AllAnswers MXResource NSResource SkipAnswer nonDefault isBlocking RawControl ReadDirent readUnlock runtimeCtx crypto/tls PrivateKey OCSPStaple Extensions NextProtos ClientAuth MinVersion MaxVersion ticketKeys *[13]uint8 scratchBuf nextCipher handshakes serverName retryCount activeCall pskBinders extensions marshalMsg PublicName innerHello *tls.alert readRecord verifyData ciphertext ScalarMult DecodedLen EncodedLen *url.Error ForceQuery WriteField readHeader readString compressor *[26]uint8 *rand.Rand ExpFloat64 setMaxSize evictCount DecodeFull firstField beginChunk *list.List MoveBefore MoveToBack httpsProxy ipMatchers *abi.TFlag IsEmbedded ReadVarint sourceFunc escapeHTML FieldStack nameNonEsc parseState savedError canAddrEnc tokenError tokenState tokenStack *chi.Route *chi.nodes MethodFunc prefixRune FindString ReplaceAll allMatches replaceAll *[1]uint32 absSec locabs addSec setLoc requireExp *jwt.Token sendCreate removePath updatePath readEvents callerSkip *zap.uints *zap.times *zap.int8s *zap.bools NextReader NextWriter returnCode ReturnCode ResumeSubs Disconnect Connecting messageIds disconnect BufferPool WithFields ForceQuote isTerminal LoggerName AppendBool AppendInt8 AppendTime AppendUint AddFloat32 AddFloat64 AddUintptr thereafter reflectBuf reflectEnc RawSubject MaxPathLen OCSPServer rawSubject constraint systemPool *[28]uint8 *[66]uint8 *[5]uint64 Properties asInternal properties hash/crc32 CgoEnabled *[18]uint8 unlockSlow lengthMask growthLeft localDepth getWithKey tombstones clearSmall *[48]uint8 FieldTrack RegabiArgs NewInliner MarkerOnly *[50]uint8 ordInverse polynomial SaltLength crypto/rsa saltLength Precompute precompute *hash.Hash crypto/aes crypto/des *aes.Block *aes.block crypto/rc4 *[5]uint32 flushChild privateKey crypto/md5 *pem.Block availWrite writeSlice makeReader fillWindow writeBlock *[19]int32 *[17]int32 offsetFreq storedSize bulkHasher hashOffset blockStart modInverse montgomery ModInverse scaleDenom *norm.Form SpanString appendRune assignRune initString setFlusher *norm.Iter InitString appendJSON *syntax.Op calcHeight parseClass IsBoolFlag *flag.Flag Float64Var copyNeeded TryAcquire WillRetain AddNetwork writeErrMu readLength handlePong handlePing endMessage flushFrame writeFatal AppendByte RightAlign *asn1.Flag IsCompound stringType isCompound crypto/dsa Parameters *pkix.Name appendRDNs PostalCode CommonName ExtraNames IsOperator FirstClass exited~ ExtraFiles StderrPipe StdoutPipe childStdin checkpoint unreadRune TypeForKey *[57]uint8 *[97]uint8 isInfinity GCDVarTime IsMinusOne *hmac.HMAC sumGeneric IsNegative SystemName systemName mappingIDX SampleType DropFrames KeepFrames PeriodType CheckValid Compatible compatible postDecode addCPUData addMapping havePeriod *[11]uint8 *sha3.SHA3 writeLines sync/atomic *[0]*string *chan error wroteHeader handlerDone poolDequeue *fmt.buffer writeString *func(bool) precPresent wrappedErrs WriteString unknownType *[1]uintptr *[3]uintptr *[4]uintptr *func() int *net.IPMask DefaultMask IsMulticast MarshalText SetDeadline isConnected ctrlNetwork ReadMsgUnix SyscallConn WriteToUnix *net.IPAddr IsTemporary ReadFromUDP WriteMsgUDP readFromUDP *net.IPConn mptcpStatus *[]net.Addr *net.ipAttr ai_socktype ai_protocol *net.result *net.byName lookupGroup LookupCNAME LookupNetIP goLookupPTR goLookupSRV goLookupTXT lookupCNAME *net.Dialer DialContext *[5]uintptr StreamEnded maxReadSize debugFramer stringToken HasPriority ErrorDetail WriteGoAway writeUint16 writeUint32 CloseStream activeConns MaxHandlers IdleTimeout PingTimeout WriteSubset writeSubset WriteHeader Partitioned lastSegment otherValues WithContext isH2Upgrade closeNotify writeHeader CloseNotify bodyAllowed readRequest ReadTimeout BaseContext ConnContext idleTimeout byteTimeout setConnFlow doneServing readFrameCh pushEnabled curHandlers canonHeader pingTimeout PseudoValue NumSettings httpResCode contentType closeStream onIdleTimer processData processPing readPreface resetStream resetQueued hasTrailers bodyRemains readTrailer addSegments findHandler registerErr canceledErr closeLocked reqCanceler h2transport dialConnFor bytesRemain sentHeaders pastHeaders readAborted abortStream goAwayDebug reqHeaderMu closeIfIdle healthCheck ErrorString maxStreamID SortStrings AuthMethods *[512]uint8 *[6]uintptr *os.dirInfo stdoutOrErr setDeadline *os.rawConn *os.timeout *[]*os.File *os.Process closeHandle *[16]uint16 badCharSkip *[256]uint8 ContainerID NoSetGroups UidMappings GidMappings AmbientCaps UseCgroupFD Nanoseconds MarshalJSON *time.Timer SendRequest *api.Server sendSuccess GetAudience GetIssuedAt PathAllowed currentPath reloadMutex lastModTime *[2][]uint8 GetLogLevel ContentType *sentry.Dsn defaultPort DebugWriter Environment sdkMetaData breadcrumbs attachments fingerprint requestBody RemoveExtra SetContexts *sentry.Hub lastEventID LastEventID LoadOrStore *sync.Mutex readerCount *sync.eface rUnlockSlow *io.discard panicNotMap FieldByName OverflowInt SetMapIndex abiTypeSlow capNonSlice extendSlice lenNonSlice stackAssign *[9]uintptr HashTrieMap *netip.Addr withoutZone bitsSetFrom *[8]uintptr *complex128 pctabOffset runtimehash funcnametab findfunctab textsectmap deferreturn stackguard0 stackguard1 syscalltick syscallwhen speciallock ensureSwept memProfRate *func(uint) pushAll minWhenHeap acquiretime releasetime bytesMarked flushedWork raceprocctx pinnerCache newSigstack createstack waitunlockf isMutexWait preemptStop trackingSeq *[68]uint64 totalAllocs mCacheInUse buckHashSys GCPauseTime GCTotalTime globalsScan hasOverflow wakeupExtra overflowBuf publishInfo setEventErr *[128]uint8 *[16]uint64 slotsOffset errIntegral errOverflow FreeObjects HeapObjects MCacheInuse BuckHashSys NumForcedGC *[1][]int32 authorities additionals OPTResource PTRResource SOAResource SRVResource TXTResource *fs.dirInfo ConnectDone SetBlocking writeUnlock prepareRead cipherSuite *tls.Config Certificate CipherSuite ECHAccepted SendAsRetry WrapSession writeKeyLog handshakeFn echAccepted packetsSent hpkeContext echRejected serverShare loadSession certificate CryptBlocks serverHello *[133]uint8 *[1][]uint8 WithPadding *log.Logger *url.Values EscapedPath setFragment passwordSet RawFragment currentPart NextRawPart disposition Multistream multistream crypto/rand *func(int8) *[607]int64 NormFloat64 PutIdleConn hasNetHooks *hpack.node searchTable shouldIndex evictOldest byNameValue EmitEnabled SetEmitFunc emitEnabled LatinOffset InsertAfter MoveToFront insertValue proxyForURL FieldAlign_ *abi.Method DataChecked *[15]uint64 ReturnIsPtr *abi.FuncID *json.field nameEscHTML byExactName valueQuoted InputOffset indentValue HandlerFunc Middlewares *chi.Routes RouteMethod routeParams InsertRoute findPattern setEndpoint middlewares *chi.Router basicWriter NewLogEntry subexpNames prefixBytes minInputLen *regexp.job shouldVisit MatchReader MatchString SubexpIndex SubexpNames *jwt.Claims setMono unixSec parseString *jwt.Parser expectedAud expectedIss expectedSub *[]big.Word renamedFrom inotifyFile cookieIndex handleEvent isRecursive *zap.Option *zap.Logger development errorOutput WithOptions *zap.int16s *zap.int32s *zap.int64s WriteSyncer *zap.Config PingHandler PongHandler ReadMessage Subprotocol WaitTimeout *mqtt.Store *mqtt.Token *[]*url.URL HTTPHeaders WillEnabled WillPayload SetClientID SetPassword SetUsername IsConnected Unsubscribe deleteRoute incomingPub *mqtt.route WriterLevel ForceColors SortingFunc appendValue sentryScope TrimmedPath AppendArray AppendInt16 AppendInt32 AppendInt64 AppendUint8 AddDuration ErrorOutput EncodeEntry appendFloat jsonEncoder crypto/x509 *[]x509.OID ExtKeyUsage IPAddresses addCertFunc buildChains validPolicy *[]*big.Int shouldBuild UseAllFiles ReleaseTags *maps.table deleteSmall directoryAt growToSmall growToTable globalDepth globalShift *cpu.option LoadAcquire *[32]uint64 ShouldPrint matchResult addJacobian Precomputed *cipher.cbc *[60]uint32 *rc4.Cipher crypto/sha1 openGeneric sealGeneric AddASN1Enum AddASN1NULL MarshalASN1 Decapsulate *ecdh.Curve crypto/ecdh GenerateKey *md5.digest *[][]uint32 finishBlock readHuffman fillDeflate initDeflate *[248]uint8 codegenFreq literalFreq dynamicSize indexTokens writeTokens *norm.input appendSlice charinfoNFC insertFlush returnSlice *expvar.Var appendGroup checkHeight checkLimits maybeConcat parseEscape parseRepeat wholeRegexp *flag.Value DurationVar MessageType FixedHeader ReservedBit WillMessage ReturnCodes bypassZones bypassHosts forwardDial subprotocol readMaskPos readMaskKey handleClose AppendBytes AppendFloat TrimNewline application Constructed *ast.Object *exec.Error success~ SysProcAttr lookPathErr childStderr childStdout *cases.info *bigmod.Nat *[200]uint8 readGeneric *sha3.SHAKE systemNameX functionIDX locationIDX dropFramesX keepFramesX stringTable pbValueType readMapping stringIndex *socks.Addr *socks.Conn StringToBuf HasVariants setTagsFrom deleteRange resizeRange *[4][]uint8 *compact.ID crypto/sha3 MultiplyAdd handlePanic startEscape updateWidth *[16]uintptr calledHeader *func() bool *func(error) *func(uint8) *func(int32) writePadding *net.OpError *net.UDPAddr *net.TCPAddr *net.Buffers *func(int64) writeBuffers listenStream readMsgInet4 readMsgInet6 writeToInet4 writeToInet6 ReadFromUnix WriteMsgUnix *net.TCPConn MultipathTCP SetKeepAlive readDeadline lookupValues *net.UDPConn ListenPacket *net.rawConn AppendBinary HardwareAddr *net.nssConf *net.timeout ai_canonname serverOffset StrictErrors LookupIPAddr lookupIPAddr strictErrors dialParallel *[][4]uint64 *[1]net.Addr getDataFrame maxWriteSize HeadersEnded WriteHeaders AdjustStream registerConn *http.Server *http.Header Uncompressed *http.Cookie ProtoAtLeast comparePaths CookiesNamed SetBasicAuth SetPathValue isReplayable hitReadLimit setReadLimit hijackLocked WriteTimeout TLSNextProto nextProtoErr doKeepAlives shuttingDown wroteFrameCh maxFrameSize writingFrame sentPingData hpackEncoder shutdownOnce PseudoFields checkPseudos LastStreamID noteBodyRead processFrame sendServeMsg setConnState writeHeaders wroteHeaders *http.mp4Sig earlyCloseFn *http.noBody doEarlyClose FlushHeaders extraHeaders readResponse wroteRequest targetScheme removeOldest idleConnWait connsPerHost MaxIdleConns queueForDial connPoolOnce RoundTripOpt initConnPool newTLSConfig pastTrailers copyTrailers writeRequest atomicReused seenSettings nextStreamID addConnCalls RoundTripErr sendResponse *http.Pusher *[1024]uint8 *[2048]uint8 *[4096]uint8 *[8192]uint8 *[]io.Reader *http.Client DialWithConn proxyNetwork proxyAddress Authenticate *os.fileStat Readdirnames spliceToFile replacements Unshareflags Microseconds Milliseconds *[]time.zone AppendFormat appendFormat *time.Ticker TokenHandler *auth.Claims GetNotBefore LogFilePaths SentryFirstN scheduleType *sentry.User SetUnhandled GetTimestamp *sentry.Span overflowOnce ID json:"id" OS json:"os" GetProjectID GetPublicKey GetSecretKey integrations CaptureEvent prepareEvent processEvent IgnoreErrors Integrations spanRecorder traceContext SetException ApplyToEvent contextLines ignoreErrors *sentry.span AssignableTo *[]*abi.Type *sync.Locker *sync.noCopy *atomic.Bool *[]io.Writer *io.WriterTo CanInterface FieldByIndex MethodByName OverflowUint SetIterValue panicNotBool assignFloatN makeFuncCtxt *[256]uint64 initSlow appendTo4In6 RuntimeError *[]complex64 *[]*abi.ITab linktimehash modulehashes takeFromBack deferBitsPtr initHeapBits maybeRunChan unlockAndRun dequeueSudoG readyNextGen statusTraced heapScanWork deferpoolbuf goidcacheend gcAssistTime limiterEvent *[32]uintptr captureStack recordUnlock *runtime.mOS profileTimer isExtraInSig mLockProfile pcvalueCache locksHeldLen atomicstatus paniconfault inMarkAssist runnableTime gcCyclesDone GCAssistTime takeOverflow overflowTime *chan uint32 InUseObjects AllocObjects HeapReleased PauseTotalNs AAAAResource AllQuestions AnswerHeader SkipQuestion checkAdvance skipResource Undocumented *fs.FileInfo *fs.FileMode *fs.DirEntry ConnectStart *poll.String ReadMsgInet4 ReadMsgInet6 WriteToInet4 WriteToInet6 prepareWrite waitCanceled ocspResponse alpnProtocol SessionState *tls.CurveID CipherSuites OCSPResponse Certificates KeyLogWriter cipherSuites finishedHash handshakeErr maxEarlyData ocspStapling retryConfigs RecordHeader sessionState *tls.prfFunc certificates CombinedMult *tls.cbcMode readFinished sendFinished masterSecret AppendDecode AppendEncode DecodeString dashBoundary ReadCodeLine ReadDotBytes ReadDotLines ReadResponse readCodeLine lastRuneSize *gzip.Reader *gzip.Header decompressor *gzip.Writer *rand.reader AppendUint16 AppendUint32 AppendUint64 *func(int16) *rand.Source *[256]uint32 WroteHeaders WroteRequest maxSizeLimit decodeString InsertBefore PushBackList internal/abi *abi.NameOff *abi.TypeOff *abi.TextOff *abi.Imethod *abi.PtrType *abi.RegArgs *json.Number reflectValue byFoldedName literalStore errorContext indentPrefix *chi.Context routePattern RoutePattern *[]chi.Route *[]chi.nodes *chi.nodeTyp replaceChild BytesWritten *[]time.Time MatchRunePos ExpandString FindAllIndex FindSubmatch tryBacktrack appendTo verifyIssuer validMethods decodeStrict SignedString *[1]big.Word *fsnotify.Op *zap.uint16s *zap.uint32s *zap.uint64s *zap.payload *[]io.Closer buildEncoder buildOptions RegisterSink CloseHandler SetReadLimit WriteControl WriteMessage flowComplete *mqtt.Client CleanSession ConnectRetry WillRetained SetTLSConfig *mqtt.client *mqtt.status lastIssuedID *mqtt.router lastReceived commsStopped *mqtt.Logger *logrus.Hook ReportCaller ReplaceHooks SetFormatter releaseEntry DisableQuote PadLevelText needsQuoting printColored FlushTimeout FrameMatcher LevelEnabler flushTimeout filterFrames AppendObject AppendString AddComplex64 AddReflected writeContext EqualASN1OID SerialNumber SubjectKeyId *x509.sum224 systemVerify *[1]x509.OID RoundTripper *crc32.Table directorySet putSlotSmall replaceTable internal/cpu StoreRelease BoringCrypto SpinbitMutex ShouldEnable *bisect.cond *crypto.Hash crypto/ecdsa XORKeyStream *cipher.AEAD productTable *sha1.digest sharedSecret *hpke.Sender AddASN1Int64 BytesOrPanic MasterSecret NewPublicKey newPublicKey encoding/pem *[512]uint32 tryWriteCopy huffmanBlock *flate.hcode *flate.token shiftOffsets *[257]uint32 *big.divisor convertWords divRecursive multiSegment *norm.qcInfo charinfoNFKC LastBoundary NextBoundary nextBoundary insertSingle insertUnsafe *expvar.Func *syntax.Inst *syntax.Prog defaultUsage ProtocolName UsernameFlag PasswordFlag writeBufSize readErrCount advanceFrame beginMessage Subprotocols *buffer.Pool *color.Color defaultValue Organization *ast.ObjKind *token.Token CgoSupported ProcessState sysUsage~ userTime~ ProcessState childIOFiles goroutineErr IsPrivateUse Canonicalize math/rand/v2 SetGenerator p256BaseMult fipsApproved resetToBytes *sha3.Digest writeGeneric HasFunctions HasFilenames HasFileLines *pprof.label *[][]uintptr emitLocation startMessage RemakeString genCoreBytes handlerHeader contentLength closeNotifyCh *func() error *func(string) *func() int32 *func(uint64) *fmt.fmtFlags handleMethods *fmt.Stringer *go.shape.int *net.UnixAddr *net.sockaddr IsUnspecified UnmarshalText *net.UnixConn SetReadBuffer readFromInet4 readFromInet6 writeMsgInet4 writeMsgInet6 writeDeadline *net.DNSError *net.Listener *net.fileAddr MarshalBinary *[]net.IPAddr singleRequest *chan []uint8 canonicalName *net.Resolver *net.addrList goLookupCNAME fallbackDelay FallbackDelay *func(func()) *func(uint32) replyToWriter headerFragBuf WritePriority WriteRawFrame WriteSettings readMetaFrame *func(uint16) HeaderEncoder *http.Handler *http.Request ContentLength *http.pattern *http.segment conflictsWith MultipartForm PostFormValue *func() int64 requiresHTTP1 finalTrailers finishRequest nextProtoOnce listenerGroup trackListener remoteAddrStr advMaxStreams shutdownTimer readIdleTimer RegularFields HasDuplicates checkPriority processGoAway declBodyBytes onReadTimeout *http.htmlSig *http.textSig didEarlyClose bodyReadError GetClientConn *chan<- error writeLoopDone cancelRequest getCtxForDial *http.connLRU CancelRequest customDialTLS newclientconn connPoolOrDef NewClientConn newClientConn requestedGzip reqBodyClosed sentEndStream getConnCalled pendingResets SetDoNotReuse closeForError encodeHeaders onIdleTimeout tooIdleLocked addConnLocked getClientConn reqDidTimeout needsContinue *http.Flusher *[16384]uint8 *[32768]uint8 checkRedirect CheckRedirect copyFileRange *os.LinkError *os.noWriteTo pidDeactivate *[256][]uint8 *strings.span *syscall.Conn firstZoneUsed UnmarshalJSON *[1]time.zone needFiltering GetConnection HealthHandler mqttPublisher *auth.Secrets *<-chan error GenerateToken readIAIDToken secretsAtomic secretManager iaidTokenPath *func() uint8 JWTSecretPath IAIDTokenPath MQTTBrokerURL *sentry.Frame *sentry.Event *sentry.Level SerializeTags sdkIdentifier EnableTracing TracesSampler HTTPTransport MaxErrorDepth IsTransaction ToSentryTrace clientOptions *sentry.Scope AddAttachment AddBreadcrumb RemoveContext readSlicew *sentry.batch *sentry.event *sentry.stack *sentry.layer internal/sync loadAndDelete LoadAndDelete *[144]uintptr *[]abi.Method InterfaceType IsDirectIface *[]sync.eface *sync.RWMutex *atomic.Value *atomic.Int32 *atomic.Int64 *io.nopCloser *io.eofReader *io.onceError *reflect.Type *reflect.Kind *reflect.flag InterfaceData OverflowFloat UnsafePointer ConvertibleTo stepsForValue *[]complex128 *interface {} *runtime.Func filetabOffset takeFromFront *runtime.coro decPinCounter getPinnerBits incPinCounter newPinnerBits nextFreeIndex pinnerBitSize reportZombies setPinnerBits changegstatus maybeRunAsync acquireStatus *[253]uintptr checknonempty *[512]uintptr scannedStacks *runtime.note *[65504]uint8 varintReserve oldthrowsplit cgoCallersUse waitTraceSkip signalPending hasCgoOnStack preemptShrink parkingOnChan nocgocallback trackingStamp fipsIndicator gcAssistBytes missingMethod inputOverflow GCCPUFraction IncNonDefault CNAMEResource SkipAuthority resHeaderType *fs.PathError internal/poll *poll.fdMutex *poll.SysFile ZeroReadIsEOF GetsockoptInt ReadFromInet4 ReadFromInet6 SetsockoptInt WriteMsgInet4 WriteMsgInet6 AcceptableCAs UnwrapSession Renegotiation DecryptTicket EncryptTicket decryptTicket encryptTicket mutualVersion supportsCurve *tls.halfConn trafficSecret *tls.keyShare sessionTicket alpnProtocols pskIdentities originalBytes updateBinders MaxNameLength serverNameAck selectedGroup readFromUntil readHandshake pointToAffine establishKeys decodeQuantum *url.Userinfo net/textproto ReadLineBytes readLineSlice *bufio.Writer *bufio.Reader *bytes.readOp *bytes.Buffer *bytes.Reader compress/gzip DefaultReader *[]hpack.node maxTableIndex *list.Element PushFrontList *abi.FuncType IntRegArgAddr *abi.FuncFlag encoding/json *json.encOpts *[]json.field *json.scanner popParseState convertNumber rescanLiteral *json.Decoder tokenValueEnd *json.Encoder SetEscapeHTML RoutePatterns *chi.endpoint *[4]chi.nodes nextRoutePath runtime/debug *debug.Module *regexp.input regexp/syntax *regexp.queue *regexp.entry *[]regexp.job FindAllString LiteralPrefix stripMono VerifyOptions verifySubject useJSONNumber EncodeSegment SigningString DecodeSegment *[]zap.Option sweetenFields *zap.errArray *zap.uintptrs *zap.float32s *zap.float64s writeBufs *mqtt.Message *mqtt.message AutoReconnect SetBinaryWill SetResumeSubs OptionsReader Disconnecting willReconnect lastErrorTime *mqtt.inbound *logrus.Entry *logrus.Level SetBufferPool getBufferPool writerScanner DisableColors FullTimestamp LoggerNameKey *zapcore.Core CapitalString unmarshalText AppendFloat32 AppendFloat64 AppendUintptr AddByteString AddComplex128 OpenNamespace IncCheckReset UnmarshalYAML EncoderConfig appendComplex safeAddString *[]*net.IPNet splitPathList InstallSuffix SplitPathList IsRateLimited isRateLimited getWithoutKey *[]cpu.option stringOffsets *atomic.Uint8 *bisect.dedup *rsa.CRTValue crypto/cipher *cipher.Block roundKeysSize blockExpanded *hpke.hkdfKDF LabeledExpand *hpke.context *hpke.uint128 pendingLenLen pendingIsASN1 AddASN1BigInt AddASN1Uint64 addASN1Signed addBase128Int encryptionKey decryptionKey NewPrivateKey newPrivateKey *flate.Reader *flate.byFreq byteAvailable *flate.Writer *fips140.Hash defaultReader *drbg.Counter reseedCounter expNNWindowed ProbablyPrime BoundaryAfter Decomposition FirstBoundary firstBoundary combineHangul insertOrdered compatibility *syntax.Error *syntax.Flags leadingRegexp leadingString *[]*flag.Flag *flag.FlagSet ErrorHandling PrintDefaults errorHandling notifyWaiters *proxy.Dialer AddFromString *proxy.direct readRemaining messageReader *map[int]bool *asn1.encoder encoding/asn1 ToRDNSequence StreetAddress *baggage.List *baggage.Item parentIOPipes *language.Tag SetTypeForKey BaseLanguages *rand.ChaCha8 BitLenVarTime montgomeryMul padAndPermute *ecdh.curveID buildIDOrFile *profile.Line DurationNanos runtime/pprof *pprof.memMap firstPCFrames *pprof.pcDeck *socks.Dialer HasExtensions acceptMinSize setShortBytes signedRadix16 flushNoDefers terminateCell CompareAndSwap *[]*os.dirInfo didCloseNotify *func() string *fmt.wrapError *func([]uint8) truncateString *fmt.Formatter SetWriteBuffer listenDatagram *net.noWriteTo *net.AddrError *func(uintptr) *func() uint16 *net.Interface MulticastAddrs *net.nssSource *net.temporary *net.dnsConfig getLookupGroup ControlContext *net.sysDialer doDialTCPProto *[1]net.IPAddr debugFramerBuf SetReuseFrames WriteRSTStream unregisterConn *http.Response *http.SameSite bodyIsWritable compareMethods outgoingLength backgroundRead *http.response declareTrailer MaxHeaderBytes ListenAndServe closeIdleConns maxHeaderBytes countErrorFunc headerWriteBuf ForeachSetting curOpenStreams processHeaders processSetting upgradeRequest BreakWithError CloseWithError closeWithError onWriteTimeout sentContentLen *http.sniffSig *http.exactSig ResponseToHEAD *http.ServeMux *http.muxEntry *http.wantConn connsPerHostMu DialTLSContext ReadBufferSize readBufferSize removeIdleConn tryPutIdleConn dialClientConn respHeaderRecv encodeTrailers forceCloseConn forgetStreamID http2Transport *[]fs.FileInfo *[]fs.DirEntry *http.Hijacker *http.canceler validateTarget **http.Request *os.unixDirent *os.noReadFrom *func() uint64 goodSuffixSkip *syscall.Errno *syscall.Iovec *time.Duration *time.Location *agent.Request *agent.Command ExecuteCommand executeRequest ValidateAPIKey isRelevantFile *config.Config CommandTimeout SentryTagsPath waitForPublish *[]logrus.Hook *sentry.Thread *sentry.Metric SerializeValue *sentry.SpanID collectProfile *sentry.Client *sentry.scheme RequestHeaders CaptureCheckIn CaptureMessage setupTransport SendDefaultPII MaxBreadcrumbs GetTransaction SetFingerprint SetRequestBody ConfigureScope compareAndSwap json:"dsn" json:"sdk" *func(float64) mustBeExported *atomic.noCopy *atomic.Uint32 *atomic.Uint64 *io.ReadCloser *io.ReaderFrom *io.ReadWriter *io.ByteWriter *io.RuneReader readCloseError *io.PipeReader *io.PipeWriter *reflect.Value *reflect.rtype *reflect.visit StringExpanded *netip.uint128 *runtime.Frame funcnameOffset *runtime._func *runtime.stack *runtime.gobuf *runtime.mspan *runtime.mutex lockRankStruct manualFreeList typePointersOf *runtime.gList *runtime.sudog *runtime.hchan *runtime.timer *runtime.waitq *runtime.wbBuf runSafePointFn traceBufHeader becomeSpinning isWaitingForGC asyncSafePoint tinyAllocCount largeFreeCount smallFreeCount heapStatsDelta totalAllocated gcCyclesForced ScavengeBgTime canWriteRecord AllAdditionals AllAuthorities SkipAdditional SkipAllAnswers resourceHeader resHeaderValid *godebug.value nonDefaultOnce increfAndClose *poll.pollDesc SetsockoptByte *go.shape.bool ForgetUnshared *tls.quicState *tls.QUICEvent verifiedChains *[]tls.CurveID VerifiedChains *tls.ticketKey GetCertificate getCertificate setErrorLocked handshakeMutex closeNotifyErr clientFinished serverFinished clientProtocol *tls.echConfig *tls.echCipher VerifyHostname pickTLSVersion ScalarBaseMult *tls.certCache EncodeToString mime/multipart nlDashBoundary ReadMIMEHeader *rand.Source64 Got100Continue Got1xxResponse *[]*hpack.node *hpack.Encoder allowedMaxSize *hpack.Decoder SetEmitEnabled container/list domainMatchers *abi.ArrayType *[]abi.Imethod *abi.SliceType *json.isZeroer pushParseState arrayInterface valueInterface *chi.methodTyp methodsAllowed *chi.endpoints ResponseWriter *regexp.Regexp maxBitStateLen prefixComplete *regexp.thread *regexp.inputs canCheckPrefix ReplaceAllFunc *jwt.MapClaims *jwt.Validator verifyAudience verifyIssuedAt *zap.durations *[1]zap.Option SetPingHandler SetPongHandler UnderlyingConn writeFatal sessionPresent SessionPresent ConnectTimeout OnReconnecting SetHTTPHeaders SetPingTimeout ConnectionLost defaultHandler UpdateLastSent persistInbound *mqtt.commsFns *logrus.Logger *logrus.Fields IsLevelEnabled DisableSorting appendKeyValue *zapcore.Entry *zapcore.Level *zapcore.Field *func(float32) AppendDuration openNamespaces *zapcore.Clock *x509.KeyUsage MaxPathLenZero AuthorityKeyId EmailAddresses PolicyMappings *x509.CertPool *x509.lazyCert CheckSignature *[]crc32.Table *build.Context goodOSArchFile *ratelimit.Map *sync.hashFunc directoryIndex *sys.NotInHeap *[7]cpu.option RegabiWrappers *godebugs.Info *bisect.Writer *[]bisect.cond *crypto.Signer crypto/ed25519 doubleJacobian *rsa.PublicKey *cipher.Stream *des.desCipher XORKeyStreamAt LabeledExtract incrementNonce exporterSecret inContinuation AddASN1Boolean AddASN1UTCTime compress/flate *[]flate.hcode *[]flate.token offsetEncoding writeBlockHuff *[32768]uint32 maxInsertIndex setFromScanner BoundaryBefore IsNormalString *norm.formInfo *norm.iterFunc *pprof.handler net/http/pprof *syntax.ranges *syntax.InstOp *[]syntax.Inst *syntax.Regexp *syntax.parser parseClassChar parsePerlFlags *flag.intValue *flag.boolFlag writeMultiline *proxy.PerHost bypassNetworks readDecompress NetDialContext *buffer.Buffer *asn1.RawValue *dsa.PublicKey systemTime~ createdByStack CombinedOutput *cases.context *cases.mapFunc *language.Base *ecdsa.curveID generatorTable affineFromMont p256ScalarMult InverseVarTime *sha256.Digest *sha512.Digest *field.Element carryPropagate HasLineNumbers *profile.Label *[]pprof.label *pprof.newFunc *pprof.Profile *pprof.locInfo *pprof.profMap *socks.Command SuppressScript findTypeForKey text/tabwriter *[0]*os.dirInfo *chan os.Signal *chan struct {} writeContinueMu closeAfterReply propagateCancel *func() []error *fmt.wrapErrors *func(int) bool *fmt.GoStringer IsGlobalUnicast matchAddrFamily SetReadDeadline *net.noReadFrom *net.ParseError *net.PacketConn writeToAddrPort SetMultipathTCP KeepAliveConfig UnmarshalBinary isAddrinfoErrno *net._Ctype_int *net.dialResult *map[int]string *map[string]int resolveAddrList testHookDialTCP rUnlockSlow getLineFromData *[128][4]uint64 internal/bisect *func() []uint8 ReadMetaHeaders WriteDataPadded checkFrameOrder ReadIdleTimeout *http.keyValues sortedKeyValues *[]*http.Cookie *[]http.segment MultipartReader expectsContinue multipartReader *http.ConnState SendPingTimeout *http.Protocols handleReadError requestTooLarge unackedSettings needsFrameFlush readIdleTimeout canonicalHeader handlePingTimer onReadIdleTimer onSettingsTimer onShutdownTimer processPriority processSettings scheduleHandler startFrameWrite writeFrameAsync *http.http2pipe closeDoneLocked closeNotifierMu closeNotifierCh *http.maskedSig ReadWriteCloser *http.socksAddr matchingMethods matchOrRedirect *func(int, int) *http.Transport waitForContinue dialsInProgress TLSClientConfig MaxConnsPerHost IdleConnTimeout WriteBufferSize decConnsPerHost writeBufferSize idleConnTimeout totalHeaderSize get1xxTraceFunc wantSettingsAck streamsReserved pendingRequests addStreamLocked idleStateLocked addConnIfNeeded *func([]string) ConnectionState *http.CookieJar **http.Response *func() uintptr setReadDeadline *os.processMode pidfdSendSignal *signal.handler *strings.Reader *syscall.RtAttr *syscall.Signal *syscall._Gid_t *syscall.Rlimit *syscall.Rusage *syscall.Stat_t *time.zoneTrans *chan time.Time lookupFirstZone CloseConnection *auth.claimsKey ValidateRequest *mqtt.Publisher *sentry.EventID *sentry.SdkInfo *[]sentry.Frame *sentry.Request *[]*sentry.Span *sentry.TraceID *sentry.Sampled UpdateFromEvent Source json:"-" eventProcessors *sentry.CheckIn AvailableBuffer cachedLocations lookupWithValue ExportedMethods exportedMethods *sync.poolLocal *sync.poolChain *sync.WaitGroup *atomic.align64 *atomic.Uintptr *io.multiWriter *io.multiReader *io.WriteCloser *io.ByteScanner writeCloseError *reflect.Method FieldByIndexErr FieldByNameFunc OverflowComplex stringNonString *reflect.abiSeq *[]reflect.Type bitsClearedFrom *unsafe.Pointer *[]interface {} *runtime._defer *runtime.Pinner *runtime.pinner *runtime._panic *runtime.sigset *runtime.mcache *runtime.gcBits markBitsForBase prepareForSweep *runtime.timers maybeWakeLocked minWhenModified setStatusTraced statusWasTraced *runtime.gcWork *runtime.lfnode vgetrandomState g0StackAccurate inPtrScalarBits largeAllocCount smallAllocCount GCDedicatedTime deferBitsOffset sleepController *runtime.Frames AuthorityHeader UnknownResource resHeaderOffset resHeaderLength *nettrace.Trace *tls.activeCert extMasterSecret waitingForDrain transportParams SupportedCurves SupportedPoints SupportedProtos ResumptionState closeNotifySent updateRequested *[]tls.keyShare supportedCurves supportedPoints ticketSupported encapsulatedKey innerTranscript clientHandshake handleKeyUpdate makeClientHello readClientHello readRecordOrCCS retryReadRecord sendAlertLocked serverHandshake echRetryConfigs RetryConfigList *tls.cthWrapper ConstantTimeSum preMasterSecret crypto/elliptic normalizeScalar pointFromAffine *tls.AlertError *tls.cacheEntry doFullHandshake pickCipherSuite *[4]tls.CurveID *[5]tls.CurveID encoding/base64 EscapedFragment *multipart.Part *multipart.Form isFinalBoundary populateHeaders *sort.Interface encoding/binary *rand.rngSource Wait100Continue tableSizeUpdate *idna.runeError *abi.StructType *json.Marshaler *json.jsonError addErrorContext objectInterface notFoundHandler NotFoundHandler updateSubRoutes *chi.contextKey MatchEmptyWidth *regexp.machine *[]regexp.entry FindAllSubmatch FindReaderIndex FindStringIndex verifyExpiresAt verifyNotBefore ParseUnverified ParseWithClaims *fsnotify.Event *fsnotify.watch go.uber.org/zap *zap.optionFunc *zap.dictObject MarshalLogArray *zap.complex64s SetCloseHandler *mqtt.baseToken ProtocolVersion AutoAckDisabled SetCleanSession SetConnectRetry SetOrderMatters SetWriteTimeout actionCompleted lastSleepPeriod pingOutstanding forceDisconnect getWriteTimeOut persistOutbound *mqtt.component *[]logrus.Level SetReportCaller TimestampFormat *zapsentry.core BreadcrumbLevel *[]zapcore.Core AppendComplex64 AppendReflected encodeReflected resetReflectBuf *zapcore.ioCore ExtraExtensions getSANExtension hasSANExtension *baggage.Member *sync.equalFunc checkInvariants resetGrowthLeft getWithKeySmall AliasTypeParams SyncHashTrieMap *bisect.Matcher *elliptic.Curve *rsa.PSSOptions *rsa.PrivateKey *[]rsa.CRTValue NewCBCDecrypter NewCBCEncrypter *cipher.gcmAble generateSubkeys gcmPlatformData HandshakeSecret *ecdh.PublicKey *ecdh.nistCurve fastSkipHashing literalEncoding codegenEncoding generateCodegen *[131072]uint32 *flate.Resetter expNNMontgomery combinesForward QuickSpanString decomposeHangul *expvar.jsonVar *syntax.EmptyOp parseNamedClass parseRightParen swapVerticalBar *flag.uintValue writeSingleline RemainingLength *websocket.Conn WriteBufferPool *asn1.BitString *[]asn1.encoder *dsa.Parameters *pkix.Extension ContextSpecific *chan io.Reader *exec.ExitError *[]func() error *exec.ctxResult awaitGoroutines isCaseIgnorable *cases.spanFunc *[]language.Tag *ecdsa.hmacDRBG BytesCompressed bytesCompressed *bigmod.Modulus DivShortVarTime ExpShortVarTime *[42]cpu.option *profile.buffer *profile.Sample HasInlineFrames *[]profile.Line *pprof.labelMap *pprof.LabelSet addMappingEntry *pprof.protobuf *[]pprof.memMap symbolizeResult SetUniformBytes nonAdjacentForm *tabwriter.cell wants10KeepAlive canWriteContinue *go.shape.string *[1]interface {} *[2]interface {} *[3]interface {} *context.Context *context.todoCtx *context.stopCtx *func() net.Addr *func(int) error SetWriteDeadline *func(time.Time) readFromAddrPort writeMsgAddrPort *net.TCPListener SetUnlinkOnClose *net.rawListener *func() *poll.FD *net._Ctype_uint *[]net.nssSource standardCriteria *net.result[int] *net._Ctype_char *[]*bisect.dedup *chan net.result internetAddrList *map[uint64]bool internal/godebug *go.shape.*uint8 *http.http2Frame *http.http2Flags http2FrameHeader lastHeaderStream debugReadLoggerf WritePushPromise WriteSettingsAck MaxReadFrameSize WriteByteTimeout *map[string]bool TransferEncoding isProtocolSwitch UnencryptedHTTP2 *http.connReader abortPendingRead EnableFullDuplex setupHTTP2_Serve markNewGoroutine wantWriteFrameCh sawClientPreface sawFirstSettings clientMaxStreams curClientStreams curPushedStreams maxPushPromiseID needToSendGoAway writeHeaderBlock sendWindowUpdate gotTrailerHeader *http.bodyLocked registerOnHitEOF *http.byteReader *http.readResult probeRequestBody *func() net.Conn *[]*http.pattern *[]http.muxEntry mutateHeaderFunc connsPerHostWait RegisterProtocol queueForIdleConn awaitFlowControl writeRequestBody seenSettingsChan closeForLostPing writeStreamReset lastChunkOrAlloc *http.writerOnly *http.gzipReader *http.fakeLocker *http.closeIdler *http.contextKey *[]*http.Request *[]time.Duration *[4]interface {} *[5]interface {} *func(io.Reader) setWriteDeadline *os.SyscallError *os.ProcessState *[]syscall.Iovec *strings.Builder *syscall.Timeval *syscall.RawConn *time.ParseError Code json:"code" Data json:"data" RegisteredClaims APIKeyMiddleware JWTSecretPathOld SentryThereafter IAID json:"iaid" *[]zapcore.Field *[]*sentry.Frame Type json:"type" *[]sentry.Thread *[]sentry.Metric Name json:"name" Dist json:"dist" Sampled json:"-" CaptureException EventFromCheckIn EventFromMessage GetSDKIdentifier SetSDKIdentifier listIntegrations *func() []string AttachStacktrace TracesSampleRate BeforeBreadcrumb Metrics json:"-" ClearAttachments ClearBreadcrumbs readContextLines compareAndDelete CompareAndDelete *[]runtime.Frame *[]*sentry.layer *func() abi.Kind mustBeAssignable *sync.dequeueNil *sync.notifyList internal/fmtsort *io.StringWriter *reflect.ChanDir *[]reflect.Value *reflect.abiStep *reflect.abiDesc *reflect.ptrType *runtime.functab *runtime.offAddr *runtime.special freeIndexForScan isUserArenaChunk divideByElemSize markBitsForIndex refillAllocCache *[]atomic.Uint32 *runtime.workbuf gcMarkWorkerMode scannedStackSize *runtime.libcall isIdleInSynctest activeStackChans *runtime.profBuf *runtime.funcinl controllerFailed *dnsmessage.Type AdditionalHeader SkipAllQuestions *godebug.setting *godebug.Setting *poll.splicePipe splicePipeFields SetsockoptIPMreq SetsockoptLinger *[]tls.QUICEvent peerCertificates *tls.Certificate SignatureSchemes PeerCertificates *[]tls.ticketKey VerifyConnection SessionTicketKey CurvePreferences curvePreferences explicitNonceLen changeCipherSpec setTrafficSecret resumptionSecret *tls.pskIdentity *[]tls.echCipher supportedVersion selectedIdentity HandshakeContext handshakeContext quicStoreSession *tls.finishedMsg certificateTypes *tls.cipherSuite *map[uint16]bool *[1]tls.keyShare *base64.Encoding *func(io.Writer) *url.EscapeError ResolveReference dashBoundaryDash collectFragments tryGrowByReslice TLSHandshakeDone WroteHeaderField *[256]hpack.node *idna.labelError *unicode.Range16 *unicode.Range32 *abi.StructField *json.RawMessage literalInterface *json.mapEncoder *json.ptrEncoder *chi.Middlewares *chi.RouteParams *[]chi.methodTyp methodNotAllowed MethodNotAllowed maybeWriteHeader *debug.BuildInfo *[]*debug.Module *regexp.lazyFlag *regexp.bitState ReplaceAllString *jwt.NumericDate appendFormat parseNumericDate SigningMethodRSA *jwt.joinedError *fsnotify.addOpt *fsnotify.shared *fsnotify.koekje *zap.invalidPair MarshalLogObject *zap.AtomicLevel *zap.stringArray *zap.complex128s advanceFrame beginMessage WebsocketOptions OnConnectionLost OnConnectAttempt SetAutoReconnect IsConnectionOpen ConnectionStatus *mqtt.messageIds cleanUpSubscribe matchAndDispatch sleepWithBackoff internalConnLost pingRespReceived stopCommsWorkers *mqtt.DummyToken *mqtt.NOOPLogger *map[uint8]error *logrus.exitFunc *logrus.FieldMap *logrus.fieldKey DisableTimestamp QuoteEmptyFields CallerPrettyfier terminalInitOnce addSpecialFields createExceptions breadcrumbsLevel *[2]zapcore.Core *func(complex64) AppendByteString AppendComplex128 *zapcore.sampler *zapcore.counter *zapcore.Encoder AppendTimeLayout *zapcore.nopCore unmarshalOIDText ExcludedIPRanges InhibitAnyPolicy *[]x509.lazyCert *debug.Transport uncheckedPutSlot *unique.cloneSeq PreemptibleLoops CoverageRedesign *ecdsa.PublicKey precomputeLegacy *gcm.GCMForTLS12 *gcm.GCMForTLS13 AddASN1BitString callContinuation EncapsulationKey *ecdh.PrivateKey *flate.byLiteral writeStoredBlock writeFixedHeader compressionLevel divRecursiveStep trailingZeroBits TrailingZeroBits *norm.Properties combinesBackward hasDecomposition PropertiesString insertDecomposed *norm.streamSafe *norm.lookupFunc parseVerticalBar *flag.int64Value *packets.Details ClientIdentifier dialerForRequest compressionLevel setReadRemaining HandshakeTimeout *asn1.setEncoder *asn1.oidEncoder *asn1.Enumerated *asn1.RawContent *[2]asn1.encoder crypto/x509/pkix *platform.OSArch writerDescriptor *func(*exec.Cmd) *language.Script *language.Region *[]language.Base *ecdsa.Signature *profile.message *profile.decoder internal/profile *profile.Profile *profile.Mapping *[]profile.Label *profile.mapInfo addLikelySubtags setUndefinedLang *compact.fullTag *[]*http.response *chan<- os.Signal *<-chan struct {} *context.valueCtx *context.canceler *context.timerCtx *context.emptyCtx *context.stringer *func(error) bool *net.ListenConfig *net.UnixListener *net.timeoutError *net.HardwareAddr *net.nssCriterion *[0]*bisect.dedup *[]*godebug.value goLookupHostOrder *http.http2stream *http.http2Server *http.http2Framer AllowIllegalReads MaxHeaderListSize debugWriteLoggerf WriteContinuation WriteWindowUpdate maxHeaderListSize staysWithinBuffer *<-chan time.Time *func() time.Time NewWriteScheduler *[]http.keyValues *http.HTTP2Config *http.chunkWriter closeWriteAndWait ReadHeaderTimeout disableKeepAlives ListenAndServeTLS readHeaderTimeout *http.http2inflow *http.PushOptions maxClientStreamID unstartedHandlers writingFrameAsync http2HeadersFrame newResponseWriter stopShutdownTimer *http.errorReader *http.HandlerFunc *http.routingNode *http.serveMux121 *http.statusError *http.persistConn *chan<- struct {} mapRoundTripError *http.connOrError *[]*http.wantConn *http.h2Transport DisableKeepAlives ForceAttemptHTTP2 abortStreamLocked initialWindowSize CanTakeNewRequest ReserveNewRequest *http.http2sorter *iter.Seq[string] *http.closeWriter *http.rwUnwrapper makeHeadersCopier *strconv.NumError *strings.replacer *strings.trieNode *strings.Replacer *syscall.Sockaddr *syscall._Socklen *syscall.NlMsghdr *syscall.Timespec *[]time.zoneTrans *agent.RPCRequest ReleaseConnection *api.TokenRequest GetExpirationTime ValidateIAIDToken SentryEnvironment *[1]zapcore.Field *sentry.Exception *sentry.Mechanism *sentry.DebugMeta *sentry.profileOS *sentry.EventHint OriginalException *sentry.Transport AddEventProcessor setupIntegrations updateFromBaggage *[]*regexp.Regexp *sentry.batchItem *[1]*sentry.layer *[1]sentry.Thread *reflectlite.Type *func() *abi.Type *[]unsafe.Pointer *sync.copyChecker *sync.poolDequeue poolLocalInternal *fmtsort.KeyValue writeToWithBuffer *io.LimitedReader *func(int64) bool *func(complex128) *reflect.cacheKey stackCallArgsSize *netip.addrDetail marshalBinarySize *runtime.funcInfo *runtime.pcHeader *runtime.textsect *runtime.initTask *runtime.guintptr *runtime.puintptr *runtime.muintptr allocBitsForIndex refreshPinnerBits userArenaNextFree *[]*runtime.mspan *[]*runtime.sudog updateMinWhenHeap *[3]atomic.Uint32 maxStackScanDelta *runtime.traceBuf *runtime.dlogPerM profileTimerValid *runtime.lockRank goroutineProfiled *runtime.cpuStats ScavengeTotalTime float64HistOrInit incrementOverflow *runtime.stringer *runtime.pollDesc targetCPUFraction *runtime.MemStats *[2]runtime.Frame *dnsmessage.Class *dnsmessage.RCode EnableCompression internal/nettrace SetsockoptIPMreqn *tls.SessionState activeCertHandles *[8]tls.QUICEvent SupportedVersions HandshakeComplete testingOnlyDidHRR NameToCertificate sessionTicketKeys supportedVersions prepareCipherSpec *tls.keyUpdateMsg *tls.echExtension compressionMethod quicResumeSession quicSetReadSecret quicWaitForSignal sendSessionTicket writeRecordLocked *tls.finishedHash *tls.xorNonceAEAD *tls.keyAgreement *func() hash.Hash *map[string][]int readSessionTicket saveSessionTicket *multipart.Reader dispositionParams *textproto.Reader ReadContinuedLine *bufio.ReadWriter defaultReader *binary.ByteOrder *binary.bigEndian TLSHandshakeStart *[256]*hpack.node parseFieldIndexed parseFieldLiteral net/http/internal *httpproxy.Config *httpproxy.config *abi.UncommonType *json.SyntaxError *json.Unmarshaler *json.encoderFunc *json.encodeState *json.decodeState tokenValueAllowed *chi.ChainHandler *func(chi.Router) *[]*regexp.thread FindSubmatchIndex ReplaceAllLiteral *jwt.ClaimStrings parseClaimsString *fsnotify.backend *fsnotify.inotify *fsnotify.watches *fsnotify.Watcher *zap.errArrayElem *zap.invalidPairs *zap.sinkRegistry *map[string]uint8 *mqtt.MemoryStore SetConnectTimeout SubscribeMultiple setDefaultHandler attemptConnection startCommsWorkers *map[uint8]string *logrus.Formatter *logrus.MutexWrap DisableStacktrace EnableBreadcrumbs enableBreadcrumbs *zapcore.counters safeAddByteString *zapcore.errArray *x509.Certificate *[]pkix.Extension *x509.ExtKeyUsage RawTBSCertificate PermittedIPRanges PolicyIdentifiers CheckCRLSignature *x509.pubKeyEqual expectedPolicySet *baggage.Property *crc32.sse42Table makePathsAbsolute installTableSplit StaticLockRanking HeapMinimum512KiB internal/godebugs *crypto.PublicKey *ecdsa.PrivateKey *aes.KeySizeError *cipher.BlockMode *des.KeySizeError *aes.CBCEncrypter *aes.CBCDecrypter *rc4.KeySizeError addLengthPrefixed *mlkem.nttElement *ecdh.x25519Curve *flate.dictWriter *flate.compressor writeBlockDynamic writeStoredHeader *flate.tableEntry modSqrt3Mod4Prime modSqrt5Mod8Prime *map[uint32]int32 serveDeltaProfile *syntax.ErrorCode *[]*syntax.Regexp *syntax.charGroup parseUnicodeClass *stacktrace.Stack *flag.stringValue *flag.uint64Value *semaphore.waiter *websocket.Dialer NetDialTLSContext *asn1.SyntaxError *asn1.byteEncoder *pkix.RDNSequence net/http/httputil internal/buildcfg internal/platform *cases.titleCaser *nistec.p521Table *nistec.P521Point *nistec.p224Table *nistec.P224Point *nistec.p384Table *nistec.P384Point *nistec.P256Point ShiftRightVarTime *hmac.marshalable *map[string]int32 *profile.Location *profile.Function DefaultSampleType *[]*pprof.Profile *[1]runtime.Frame *socks.AuthMethod *language.scanner SetCanonicalBytes *fiat.P224Element *fiat.P384Element *fiat.P521Element *tabwriter.Writer *[]tabwriter.cell *[0]*http.response *context.cancelCtx *[1]unsafe.Pointer *func(string) bool IsLinkLocalUnicast SetKeepAliveConfig SetKeepAlivePeriod *net.notFoundError *net.canceledError *net.onlyValuesCtx ReadMsgUDPAddrPort WriteToUDPAddrPort *net.addrinfoErrno *net.buffersWriter *net.byRFC6724Info *net._Ctype_ushort *[]net._Ctype_char *[0]*godebug.value AllowIllegalWrites *http.http2ErrCode *http.http2Setting maxHeaderStringLen ContextWithTimeout *http.headerSorter *http.relationship *map[string]string ParseMultipartForm RegisterOnShutdown *chan interface {} *http.http2outflow http2PriorityParam processResetStream scheduleFrameWrite sendWindowUpdate32 *func(error) error *http.incomparable UnencryptedNetConn matchMethodAndPath *http.routingIndex *http.RoundTripper *http.writeRequest *func(http.Header) shouldRetryRequest cleanFrontCanceled DisableCompression ProxyConnectHeader tlsNextProtoWasNil hasCustomTLSDialer putOrCloseIdleConn contextWithTimeout dialTLSWithContext disableCompression closeReqBodyLocked getStartDialLocked *http.timeoutError allocatePromisedID *http.stringWriter *[]tls.Certificate blockUntilWaitable *func(uint8) error *map[string]uint64 *[1]time.zoneTrans needPathValidation *agent.AgentClient *api.ErrorResponse Error json:"error" *api.TokenResponse Token json:"token" MQTTPublishHandler IAIDAuthMiddleware SentrySamplePeriod ZapSamplingInitial *mqtt.StatusRecord Stage json:"stage" *sentry.Breadcrumb *sentry.SdkPackage *sentry.Stacktrace *sentry.Attachment *sentry.SpanStatus Model json:"model" RecoveredException EventFromException RecoverWithContext ProfilesSampleRate IgnoreTransactions transactionProfile checkInMarshalJSON defaultMarshalJSON *sentry.usageError ignoreTransactions *chan sentry.batch *sentry.errorEvent *sentry.breadcrumb CompareAndSwapNoWB *reflectlite.rtype *sync.poolChainElt *func(int64) int64 *reflect.StructTag mustBeExportedSlow *func(uint64) bool *reflect.bitVector *reflect.fieldScan *reflect.layoutKey *[]reflect.abiStep *reflect.sliceType *[]abi.StructField *[]runtime.functab *runtime.ptabEntry *runtime.bitvector *[5]unsafe.Pointer *runtime.addrRange removeGreaterEqual *runtime.mSpanList *runtime.gclinkptr *runtime.spanClass userArenaChunkFree typePointersOfType writeHeapBitsSmall *runtime.pageCache *[]*runtime._defer *runtime.timerWhen *runtime.notInHeap *runtime.throwType *runtime.mWaitList *runtime.traceTime ScavengeAssistTime canWriteTwoRecords *runtime.profIndex *runtime.timeTimer *runtime.untracedG controllerCooldown *runtime._typePair *map[string]uint16 *dnsmessage.header *dnsmessage.Parser SkipAllAdditionals SkipAllAuthorities *nettrace.TraceKey SetsockoptIPv6Mreq *singleflight.call *tls.QUICEventKind *[]*tls.activeCert NegotiatedProtocol testingOnlyCurveID GetConfigForClient InsecureSkipVerify ClientSessionCache ticketKeyFromBytes *[]tls.pskIdentity compressionMethods quicSetWriteSecret readHandshakeBytes signatureAlgorithm *tls.atLeastReader *func(uint16) bool processServerHello upcomingHeaderKeys *rand.lockedSource net/http/httptrace *hpack.HeaderField SetMaxStringLength *[]unicode.Range16 *[]unicode.Range32 *httpproxy.matcher *httpproxy.ipMatch *abi.InterfaceType *[9]unsafe.Pointer *json.errorContext *json.floatEncoder *json.structFields *json.sliceEncoder *json.arrayEncoder updateRouteHandler *regexp.inputBytes FindAllStringIndex FindStringSubmatch *jwt.SigningMethod *[]fsnotify.addOpt *fsnotify.withOpts *map[string]uint32 *[]fsnotify.koekje *func(*zap.Logger) *zap.SugaredLogger *zap.nopCloserSink *zap.errorResponse Level json:"level" newFileSinkFromURL *mqtt.ConnectToken *mqtt.PublishToken *func() mqtt.Token SetAutoAckDisabled SetProtocolVersion UpdateLastReceived *chan mqtt.inbound *logrus.BufferPool *logrus.LevelHooks levelTextMaxLength *func(string, int) *zapcore.FieldType *zapcore.multiCore *[]zapcore.counter IssuerDomainPolicy SignatureAlgorithm PublicKeyAlgorithm UnknownExtKeyUsage ExcludedDNSDomains ExcludedURIDomains AppendCertsFromPEM CheckSignatureFrom hasNameConstraints putSlotSmallFast32 putSlotSmallFast64 *chacha8rand.State *bisect.parseError *crypto.PrivateKey *crypto.SignerOpts *ed25519.PublicKey affineFromJacobian *cipher.cbcDecAble *cipher.cbcEncAble *aes.blockExpanded sealAfterIndicator AddASN1OctetString *tls13.EarlySecret *flate.dictDecoder *flate.literalNode writeDynamicHeader *flate.deflateFast probablyPrimeLucas *[]norm.Properties *[1]*syntax.Regexp *flag.float64Value *asn1.bytesEncoder *asn1.int64Encoder *asn1.multiEncoder *asn1.tagAndLength OrganizationalUnit *httputil.dumpConn *exec.wrappedError *language.Coverage *[]language.Region *[]language.Script *language.coverage *[]profile.decoder *profile.ValueType *[]*profile.Sample *profile.sampleKey defaultSampleTypeX FilterSamplesByTag *pprof.keysByCount appendLocsForStack *lazyregexp.Regexp *language.Language setUndefinedRegion setUndefinedScript *tabwriter.osError requestBodyLimitHit *context.CancelFunc *errors.errorString *func() (int, bool) ReadFromUDPAddrPort WriteMsgUDPAddrPort *net.temporaryError *func(uintptr) bool *func() poll.String *[]net.nssCriterion *func(string) error HeaderBlockFragment SetMaxReadFrameSize *func() http.Header SetUnencryptedHTTP2 startBackgroundRead setupHTTP2_ServeTLS tlsHandshakeTimeout queuedControlFrames canonHeaderKeysSize inFrameScheduleLoop newWriterAndRequest processWindowUpdate *func(interface {}) hasNonemptyTrailers *http.bodyEOFSignal matchingMethodsPath redirectToPathSlash *http.MaxBytesError *http.wantConnQueue *http.connectMethod TLSHandshakeTimeout MaxIdleConnsPerHost maxIdleConnsPerHost cleanupWriteRequest countReadFrameError isDoNotReuseAndIdle bytesFromFirstChunk *http.http2dialCall http2clientConnPool *http.ProtocolError *http.serverHandler *http.baseContexter *func() fs.FileMode *syscall.WaitStatus *syscall.Credential *time.fileSizeError appendFormatRFC3339 appendStrictRFC3339 createNewConnection *auth.Authenticator *auth.SecretManager apiKeyMissingWarned InApp json:"in_app" *[]sentry.Exception *sentry.profileInfo *sentry.Integration *func([]uint8) bool *sentry.SDKMetaData *[]fmtsort.KeyValue *io.ReadWriteCloser *func(float64) bool *reflect.structType *reflect.layoutType *reflect.ValueError *runtime.plainError *runtime.moduledata *[]runtime.textsect *runtime.modulehash *runtime.cgoCallers initOpenCodedDefers *runtime.sysmontick *[]runtime.guintptr *runtime.workbufhdr *runtime.winlibcall *runtime.waitReason *runtime.statDepSet *runtime.metricKind *runtime.profAtomic *runtime.traceFrame *runtime.metricData *dnsmessage.section *poll.errNetClosing SetsockoptInet4Addr *singleflight.Group enableSessionEvents SupportsCertificate *tls.ClientAuthType maxSupportedVersion isHandshakeComplete secureRenegotiation *tls.clientHelloMsg obfuscatedTicketAge *[]tls.echExtension *tls.serverHelloMsg *tls.transcriptHash handleRenegotiation quicWriteCryptoData *tls.certificateMsg *tls.permanentError UnmarshalCompressed *[1]tls.pskIdentity *[]x509.ExtKeyUsage *rand.runtimeSource *hpack.incomparable MaxDynamicTableSize *hpack.dynamicTable *unicode.RangeTable *httpproxy.allMatch *json.unquotedValue *json.structEncoder *func() []chi.Route DefaultLogFormatter *debug.BuildSetting *regexp.onePassProg *regexp.onePassInst *regexp.inputString *regexp.inputReader *zap.anyFieldC[int] *zap.SamplingConfig newFileSinkFromPath SetCompressionLevel *mqtt.ProxyFunction MessageChannelDepth *mqtt.ClientOptions CredentialsProvider SetOnConnectHandler SetWebsocketOptions *mqtt.backoffStatus getBackoffSleepTime *mqtt.incomingComms *logrus.defaultPool *zapsentry.ctxField *zapsentry.tagField *func(string, bool) *func(string, int8) *func(string, uint) *zapcore.optionFunc addElementSeparator closeOpenNamespaces *zapcore.errorGroup *x509.HostnameError *func() crypto.Hash *x509.PolicyMapping SubjectDomainPolicy PermittedDNSDomains PermittedURIDomains *x509.InvalidReason *x509.pssParameters *[]baggage.Property *baggage.properties *ratelimit.Category *ratelimit.Deadline *unsafeheader.Slice putSlotSmallFastPtr putSlotSmallFastStr *goexperiment.Flags *ed25519.PrivateKey *elliptic.p256Curve *cipher.gcmFallback *cryptobyte.Builder AddASN1Int64WithTag *mlkem.fieldElement *[]mlkem.nttElement *tls13.MasterSecret ResumptionBinderKey *flate.decompressor *[]flate.tableEntry *drbg.DefaultReader expNNMontgomeryEven *norm.reorderBuffer nLeadingNonStarters *pprof.profileEntry *[]*profile.Profile removeLeadingRegexp removeLeadingString *flag.durationValue *flag.ErrorHandling *semaphore.Weighted *[]socks.AuthMethod handleProtocolError *websocket.netError *map.group[int]bool *asn1.taggedEncoder *asn1.stringEncoder FillFromRDNSequence *func(func() error) *nistec.p256Element *[]nistec.p521Table *[]nistec.p224Table *[]nistec.p384Table *[]fiat.P224Element *map[string][]uint8 SetOverflowingBytes montgomeryReduction *profile.mappingKey *map[string][]int64 *[]*profile.Mapping RemoveUninteresting *pprof.countProfile *pprof.stackProfile *pprof.profMapEntry internal/lazyregexp *language.bytesSort *edwards25519.Point *[][]tabwriter.cell *context.afterFuncer *func(string) string *func(string, int32) IsLinkLocalMulticast *func([]uint8) error *net.KeepAliveConfig *net.hostLookupOrder standardStatusAction *[14]net._Ctype_char *[]net.byRFC6724Info *chan net.dialResult *func() (int, error) *map[string][]string goLookupIPCNAMEOrder *net.mptcpStatusDial *func(*bytes.Buffer) *http.http2FrameType *http.http2DataFrame *[]http.http2Setting *http.http2SettingID startWriteDataPadded MaxConcurrentStreams *http.ResponseWriter *func(int, int) bool wantsHttp10KeepAlive setInfiniteReadLimit disableWriteContinue SetKeepAlivesEnabled closeListenersLocked initialReadLimitSize *[]hpack.HeaderField *http.http2PingFrame *http.http2writeData *func(time.Duration) *func(*http.Request) writeDataFromHandler unreadDataSizeLocked *http.transferWriter *http.maxBytesReader *http.http2Transport *[]*http.persistConn *http.requestAndChan numExpectedResponses closeConnIfStillIdle cleanFrontNotWaiting CloseIdleConnections removeIdleConnLocked reqBodyContentLength maxConcurrentStreams closeIdleConnections *http.http2writePing *http.http2timeTimer *http.http2connError *http.http2httpError *func() interface {} *[]*strings.trieNode *syscall.SysProcAttr Params json:"params" *agent.RPCRequestkey *agent.UserAlignment *agent.PathFiltering handleUsedConnection Status json:"status" *api.SuccessResponse *chan fsnotify.Event *sentry.profileTrace *sentry.profileStack Frames json:"frames" Stacks json:"stacks" *[]sentry.SdkPackage *sentry.spanRecorder Locale json:"locale" Device json:"device" Trace json:"profile" *func(*sentry.Event) Attachments json:"-" tryGrowByReslicew *sentry.sourceReader SendEventWithContext Length json:"length" internal/reflectlite *func() reflect.Type *reflect.StructField *func() reflect.Kind mustBeAssignableSlow *reflect.abiStepKind *reflect.methodValue *[]*netip.addrDetail *runtime.errorString *[]runtime.ptabEntry *[]*runtime.initTask *runtime.boundsError *[136]*runtime.mspan heapBitsSmallForAddr *[32]*runtime._defer *[]runtime.timerWhen *[128]*runtime.sudog *[128]*runtime.mspan *runtime.pTraceState gcFractionalMarkTime *runtime.mTraceState *[]*runtime.traceBuf needPerThreadSyscall waitTraceBlockReason *runtime.gTraceState *func(*runtime.coro) *runtime.metricValue *func(string) func() printControllerReset *singleflight.Result *[]*x509.Certificate *tls.SignatureScheme *tls.ClientHelloInfo *tls.ConnectionState ExportKeyingMaterial GetClientCertificate SetSessionTicketKeys extendedMasterSecret encryptedClientHello SymmetricCipherSuite getClientCertificate newRecordHeaderError readChangeCipherSpec writeHandshakeRecord *tls.helloRequestMsg *tls.rsaKeyAgreement *tls.prefixNonceAEAD *tls.binaryMarshaler *func() fips140.Hash crypto/internal/hpke serverResumedSession *[1]x509.ExtKeyUsage *textproto.dotReader *binary.littleEndian GotFirstResponseByte *hpack.DecodingError *hpack.pairNameValue parseHeaderFieldRepr chunkHeaderAvailable *httpproxy.cidrMatch *[]httpproxy.matcher *abi.IntArgRegBitmap *json.MarshalerError *middleware.LogEntry FindAllSubmatchIndex ReplaceAllStringFunc *jwt.ClaimsValidator skipClaimsValidation decodePaddingAllowed *jwt.VerificationKey *[10]fsnotify.koekje *zap.anyFieldC[bool] *zap.anyFieldC[*int] *zap.anyFieldC[int8] *zap.anyFieldC[uint] *zap.errSinkNotFound WritePreparedMessage setReadRemaining *mqtt.tokenCompletor *mqtt.SubscribeToken *mqtt.MessageHandler ConnectRetryInterval MaxReconnectInterval MaxResumePubInFlight *mqtt.PacketAndToken *<-chan mqtt.inbound *zapcore.WriteSyncer *zapcore.EntryCaller *func(string, int16) *func(string, int64) *func(string, uint8) *zapcore.jsonEncoder *zapcore.TimeEncoder *zapcore.NameEncoder *zapcore.systemClock InhibitAnyPolicyZero InhibitPolicyMapping findPotentialParents checkNameConstraints *x509.rfc2821Mailbox *crc32.slicing8Table *unsafeheader.String internal/runtime/sys internal/chacha8rand *cipher.cbcDecrypter *cipher.cbcEncrypter *des.tripleDESCipher *gcm.gcmPlatformData *mlkem.encryptionKey *[3]mlkem.nttElement *[9]mlkem.nttElement *mlkem.decryptionKey ExporterMasterSecret mime/quotedprintable *flate.InternalError *[]flate.literalNode modSqrtTonelliShanks nTrailingNonStarters NextBoundaryInString *[32]norm.Properties parsePerlClassEscape go.uber.org/multierr *multierr.multiError *packets.FixedHeader *proxy.ContextDialer *[2]socks.AuthMethod newCompressionWriter *platform.osArchInfo cachedLookExtensions *chan exec.ctxResult *func() language.Tag *language.ValueError *[]*nistec.P521Point *[]*nistec.P224Point *[]*nistec.P384Point maybeSubtractModulus *impl.implementation crypto/internal/impl *map[string][2]int32 *[]*profile.Location *profile.functionKey *profile.locationKey *[]*profile.Function *[1]*profile.Profile *func(int) []uintptr *pprof.symbolizeFlag *map[[11]uint8]int16 *edwards25519.Scalar SetBytesWithClamping *[]*sync.poolChainElt *func(string, string) *chan net.result[int] *map.group[int]string *map.group[string]int *func() time.Duration *http.http2serverConn *func(uint32) []uint8 *http.http2frameCache startGracefulShutdown sendExpectationFailed shouldReuseConnection needToSendSettingsAck peerMaxHeaderListSize writeFrameFromHandler *http.http2pipeBuffer closeWithErrorAndCode processTrailerHeaders *chan http.readResult *http.redirectHandler *http.routingIndexKey shouldRedirectRLocked *http.http2writeQueue *http.http2ClientConn maxHeaderResponseSize ResponseHeaderTimeout ExpectContinueTimeout GetProxyConnectHeader alternateRoundTripper useRegisteredProtocol expectContinueTimeout abortRequestBodyWrite encodeAndWriteHeaders frameScratchBufferLen rstStreamPingsBlocked responseHeaderTimeout *http.http2dataBuffer *http.http2gzipReader *http.cancelTimerBody *http.initALPNRequest *http.socksAuthMethod *[5]http.http2Setting *func(*os.file) error *strings.stringWriter *strings.stringFinder *strings.byteReplacer *syscall.SockaddrUnix *syscall.SysProcIDMap ReadAsJsonWithEndline *agent.PathValidation *agent.AgentInterface *agent.ConnectionPool *map[string]struct {} *map[string]time.Time ZapSamplingThereafter *mqtt.PublisherConfig *[]*sentry.Attachment *[]*sentry.Breadcrumb *sentry.profileSample *sentry.DsnParseError *sentry.EventModifier *sentry.profileDevice SpanID json:"span_id" *sentry.ClientOptions *sentry.TracesSampler *[]sentry.Integration *func(*sentry.Client) *sentry.CheckInStatus json:"check_in_id" *sentry.MonitorConfig BeforeSendTransaction updateFromSentryTrace calculateContextLines *map[string][][]uint8 *sentry.noopTransport *sentry.HTTPTransport SentAt json:"sent_at" *[1]sentry.SdkPackage *io.nopCloserWriterTo *reflect.makeFuncImpl *reflect.makeFuncCtxt *netip.parseAddrError *[0]*netip.addrDetail *[]runtime.modulehash *runtime.ancestorInfo *runtime.gsignalStack allocCountBeforeCache updateMinWhenModified *runtime.limiterEvent gcMarkWorkerStartTime *runtime.mLockProfile *[2]*runtime.traceBuf *runtime.pcvalueCache *runtime.heldLockInfo *runtime.metricReader accumulateGCPauseTime *runtime.piController *dnsmessage.AResource *func() go.shape.bool internal/singleflight VerifyPeerCertificate autoSessionTicketKeys clientFinishedIsFirst marshalWithoutBinders *tls.echClientContext *tls.handshakeMessage clientSessionCacheKey connectionStateLocked processECHClientHello quicHandshakeComplete quicRejectedEarlyData hasSignatureAlgorithm *tls.constantTimeHash *map[tls.alert]string *map[x509.sum224]bool *func() *hpke.hkdfKDF *url.InvalidHostError *multipart.partReader *multipart.FileHeader *multipart.writerOnly *textproto.MIMEHeader *func([]uint8) uint16 *func([]uint8) uint32 *func([]uint8) uint64 *[1]httpproxy.matcher *map[reflect.Type]int disallowUnknownFields *json.condAddrEncoder DisallowUnknownFields tokenPrepareForDecode *[]debug.BuildSetting *[]regexp.onePassInst FindAllStringSubmatch *jwt.SigningMethodRSA *jwt.RegisteredClaims *func() zapcore.Level *zap.anyFieldC[*bool] *zap.anyFieldC[[]int] *zap.anyFieldC[int64] *zap.anyFieldC[int32] *zap.anyFieldC[int16] *zap.anyFieldC[*int8] *zap.anyFieldC[*uint] *zap.anyFieldC[uint8] *zap.anyFieldC[error] *mqtt.DisconnectToken DefaultPublishHandler *mqtt.connCompletedFn ConnectionStatusRetry forceConnectionStatus *func() *bytes.Buffer *logrus.TextFormatter *zapcore.CheckedEntry *zapcore.ArrayEncoder *func(string, uint16) *func(string, uint32) *func(string, uint64) *zapcore.LevelEncoder *zapcore.LevelEnabler *zapcore.errArrayElem *[]x509.PolicyMapping BasicConstraintsValid IssuingCertificateURL CRLDistributionPoints RequireExplicitPolicy *x509.potentialParent AddCertWithConstraint *x509.policyGraphNode *[1]*x509.Certificate internal/unsafeheader *maps.groupsReference internal/runtime/maps CompareAndSwapRelease *atomic.UnsafePointer internal/goexperiment *elliptic.unmarshaler *elliptic.CurveParams *boring.PublicKeyECDH *[]mlkem.fieldElement *flate.huffmanDecoder *flate.huffmanEncoder assignEncodingAndSize skipContinuationBytes FirstBoundaryInString *[]pprof.profileEntry *packets.PubackPacket *packets.PubrecPacket *packets.PubrelPacket *packets.SubackPacket *websocket.BufferPool *websocket.CloseError *asn1.StructuralError *asn1.fieldParameters *httputil.neverEnding *exec.goroutineStatus *map[token.Token]bool *func(*cases.context) *[56]nistec.p224Table *[96]nistec.p384Table *[96]fiat.P224Element *sha3.spongeDirection carryPropagateGeneric *[]*profile.ValueType *pprof.runtimeProfile *[]pprof.profMapEntry *pprof.profileBuilder *map[language.Tag]int *[0]*sync.poolChainElt *context.backgroundCtx *func() (uint8, error) *func([]uint8) []uint8 *func(time.Time) error *net.mptcpStatusListen *func(string) []string *map[string]net.byName *go.shape.[]net.IPAddr *map.group[uint64]bool *func(dnsmessage.Type) *http.http2chunkWriter *http.http2writeFramer *http.http2FrameHeader *map.group[string]bool *func(io.Writer) error comparePathsAndMethods closedRequestBodyEarly *http.http2bodyReadMsg *http.http2streamState *http.http2GoAwayFrame *http.http2StreamError processFrameFromReader *http.http2closeWaiter *http.readTrackingBody *http.bufioFlushWriter *http.connectMethodKey *http.transportRequest *http.responseAndError readLoopPeekFailLocked *chan http.connOrError OnProxyConnectResponse MaxResponseHeaderBytes prepareTransportCancel startDialConnForLocked peerMaxHeaderTableSize extendedConnectAllowed decrStreamReservations *http.http2missingBody *http.http2GoAwayError *http.http2addConnCall *http.http2requestBody *http.http2writeGoAway *http.http2frameParser *http.requestTooLarger *os.fileWithoutWriteTo handleTransientAcquire handleTransientRelease *syscall.SockaddrInet4 *syscall.SockaddrInet6 Command json:"command" *agent.AgentConnection WriteAsJsonWithEndline Message json:"message" checkModificationTimes *func() *buffer.Buffer *[]sentry.profileStack Samples json:"samples" json:"id,omitempty" *sentry.DebugMetaImage Version json:"version" *sentry.profileRuntime Release json:"release" Runtime json:"runtime" json:"op,omitempty" dynamicSamplingContext *sentry.BreadcrumbHint *sentry.EventProcessor transactionMarshalJSON addContextLinesToFrame *chan sentry.batchItem *go.shape.interface {} *[6]sentry.Integration *func(complex128) bool *map[reflect.Type]bool *runtime.PanicNilError *func(*runtime.pinner) *runtime.mSpanStateBox isUnusedUserArenaChunk specialFindSplicePoint writeUserArenaHeapBits *runtime.stackfreelist *[256]runtime.guintptr *runtime.synctestGroup *runtime.statAggregate addCountsAndClearFlags *runtime.wakeableSleep *[]*runtime.moduledata *godebug.runtimeStderr *poll.splicePipeFields *[][]*x509.Certificate *[]tls.SignatureScheme SessionTicketsDisabled BuildNameToCertificate *tls.RecordHeaderError handleNewSessionTicket maxPayloadSizeForWrite processCertsFromClient quicReadHandshakeBytes certificateAuthorities discardHandshakeBuffer *tls.ECHRejectionError UnverifiedCertificates *tls.endOfEarlyDataMsg *tls.ecdheKeyAgreement *func(*tls.activeCert) *map.group[uint16]bool *func(...interface {}) ReadContinuedLineBytes readContinuedLineSlice *func(io.Reader) error *func([]uint8, uint16) *func([]uint8, uint32) *func([]uint8, uint64) *httptrace.ClientTrace *httptrace.GotConnInfo *httptrace.DNSDoneInfo SetMaxDynamicTableSize *httpproxy.domainMatch *middleware.contextKey *regexp.onePassMachine *jwt.signingMethodNone *jwt.SigningMethodHMAC *[]jwt.VerificationKey *zap.anyFieldC[[]bool] *zap.anyFieldC[*int64] *zap.anyFieldC[*int32] *zap.anyFieldC[*int16] *zap.anyFieldC[[]int8] *zap.anyFieldC[string] *zap.anyFieldC[[]uint] *zap.anyFieldC[uint64] *zap.anyFieldC[uint32] *zap.anyFieldC[uint16] *zap.anyFieldC[*uint8] Hook json:"-" yaml:"-" EnableWriteCompression *mqtt.UnsubscribeToken *mqtt.WebsocketOptions *mqtt.OnConnectHandler *mqtt.ReconnectHandler CustomOpenConnectionFn SetCredentialsProvider SetMessageChannelDepth SetReconnectingHandler *mqtt.connectionStatus disconnectionCompleted *mqtt.PlaceHolderToken *map.group[uint8]error *func() []logrus.Level DisableLevelTruncation addExceptionsFromError *zapcore.writerWrapper *zapcore.ObjectEncoder *func(string, []uint8) *func(string, float32) *func(string, float64) *func(string, uintptr) *[4096]zapcore.counter *zapcore.SamplerOption *zapcore.EncoderConfig *zapcore.CallerEncoder ExcludedEmailAddresses *x509.SystemRootsError *map[string][]x509.OID internal/profilerecord *func() *sha512.Digest *rsa.PrecomputedValues crypto/internal/boring *boring.PrivateKeyECDH *cryptobyte.BuildError AddASN1GeneralizedTime AddUint8LengthPrefixed *func() *sha256.Digest *tls13.HandshakeSecret ResumptionMasterSecret *map[string]*flag.Flag *packets.ControlPacket *packets.PublishPacket *packets.ConnectPacket *packets.ConnackPacket *packets.PubcompPacket *packets.PingreqPacket golang.org/x/net/proxy enableWriteCompression newDecompressionReader *websocket.truncWriter *transform.Transformer go.uber.org/zap/buffer *asn1.bitStringEncoder *asn1.ObjectIdentifier *map[string]func(bool) *<-chan exec.ctxResult *chan<- exec.ctxResult *func() []language.Tag *[132]nistec.p521Table *func(*profile.buffer) firstPCSymbolizeResult *language.variantsSort *language.sortVariants *atomic.Pointer[string] *func(fmt.State, int32) *func(*net.netFD) error *func() (string, error) *http.http2writeContext *http.http2HeadersFrame *func() context.Context *http.http2incomparable noteBodyReadFromHandler write100ContinueHeaders shouldSendContentLength *chan http.writeRequest connectMethodForRequest http2transportTestHooks *http.http2clientStream canTakeNewRequestLocked *http.http2UnknownFrame *func() (uint32, error) *http.http2writePingAck *http.onceCloseListener *http.persistConnWriter *http.http2noBodyReader *[]http.socksAuthMethod *os.fileWithoutReadFrom handlePersistentRelease *syscall.NetlinkMessage *[]syscall.SysProcIDMap connectionCreationError validateTokenWithSecret *[]sentry.profileSample StackID json:"stack_id" *sentry.MonitorSchedule TraceID json:"trace_id" EventID json:"event_id" *sentry.SamplingContext *sentry.TransactionInfo internal/runtime/atomic *reflectlite.ValueError *sync.poolLocalInternal *func() reflect.ChanDir *func(int) reflect.Type *map[reflect.visit]bool *runtime.lockRankStruct typePointersOfUnchecked traceSchedResourceState *runtime.traceBufHeader *[][2]*runtime.traceBuf *[]runtime.heldLockInfo *[]runtime.ancestorInfo *runtime.heapStatsDelta *runtime.scavengerState *map[uint32][]*abi.Type *dnsmessage.nestedError *func(*poll.splicePipe) *tls.ClientSessionCache *tls.ClientSessionState quicTransportParameters selectedIdentityPresent verifyServerCertificate writeChangeCipherRecord *tls.serverHelloDoneMsg *func([]uint8, []uint8) *func(tls.CurveID) bool *map.group[string][]int *[1]tls.SignatureScheme *[3]tls.SignatureScheme *[4]tls.SignatureScheme *[7]tls.SignatureScheme isBoundaryDelimiterLine parseContentDisposition *httptrace.DNSStartInfo *func(string, []string) *hpack.headerFieldTable *internal.chunkedWriter *internal.chunkedReader *json.reflectWithString *map[string]*json.field *func() chi.Middlewares methodNotAllowedHandler *func(http.HandlerFunc) MethodNotAllowedHandler *middleware.basicWriter *middleware.flushWriter *func(int) (int32, int) FindReaderSubmatchIndex FindStringSubmatchIndex ReplaceAllLiteralString appendFormatRFC3339 appendStrictRFC3339 *jwt.SigningMethodECDSA *jwt.VerificationKeySet json:"jti,omitempty" *func(fsnotify.Op) bool *zap.anyFieldC[float64] *zap.anyFieldC[float32] *zap.anyFieldC[[]int64] *zap.anyFieldC[[]int32] *zap.anyFieldC[[]int16] *zap.anyFieldC[*string] *zap.anyFieldC[*uint64] *zap.anyFieldC[*uint32] *zap.anyFieldC[*uint16] *zap.anyFieldC[[]uint8] *zap.anyFieldC[uintptr] *zap.anyFieldC[[]error] *func(*zapcore.sampler) *func() go.shape.*uint8 handleProtocolError *map.group[string]uint8 protocolVersionExplicit SetConnectRetryInterval SetMaxReconnectInterval SetMaxResumePubInFlight *mqtt.backoffController reserveStoredPublishIDs *map.group[uint8]string *zapsentry.FrameMatcher *zapsentry.LevelEnabler go.uber.org/zap/zapcore *zapcore.CheckWriteHook *zapcore.ArrayMarshaler *func() zapcore.Encoder *zapcore.consoleEncoder addSeparatorIfNecessary *zapcore.leveledEnabler RawSubjectPublicKeyInfo PermittedEmailAddresses *[1][]*x509.Certificate *func(...string) string AddASN1ObjectIdentifier AddUint16LengthPrefixed AddUint24LengthPrefixed AddUint32LengthPrefixed *quotedprintable.Reader *flate.compressionLevel *flate.huffmanBitWriter crypto/internal/fips140 *map.group[uint32]int32 *encoding.TextMarshaler *map[pprof.handler]bool *map[*syntax.Regexp]int *func() packets.Details *packets.UnsubackPacket *packets.PingrespPacket *websocket.proxy_Dialer *websocket.proxy_socks5 *map[string]token.Token *exec.prefixSuffixSaver golang.org/x/text/cases *func() []language.Base isPersonalizationString TrailingZeroBitsVarTime *map.group[string]int32 *socks.UsernamePassword VariantOrPrivateUseTags *func() <-chan struct {} *context.CancelCauseFunc *func(interface {}) bool *net.UnknownNetworkError *func() ([]uint8, error) *http.http2PriorityParam *func() <-chan time.Time MaxUploadBufferPerStream *map.group[string]string onceSetNextProtoDefaults *http.http2goroutineLock *http.http2PriorityFrame *http.http2SettingsFrame *http.unsupportedTEError *[]*http.http2ClientConn *http.http2writeSettings IsHTTP2NoCachedConnError *http.erringRoundTripper *http.http2serverMessage *[]*multipart.FileHeader *func(func(string) bool) *[2]http.socksAuthMethod *func(hpack.HeaderField) *func(*os.Process) error *strings.genericReplacer *syscall.SockaddrNetlink *syscall.RawSockaddrUnix *map.group[string]uint64 *map[string]interface {} Username json:"username" json:"url,omitempty" json:"env,omitempty" *sentry.DebugMetaSdkInfo *[]sentry.DebugMetaImage Platform json:"platform" EndTime json:"timestamp" *[]sentry.EventProcessor sampleTransactionProfile json:"sdk,omitempty" *sentry.transactionEvent Filename json:"filename" *func() reflectlite.Type *func(reflect.Type) bool *runtime.boundsErrorCode setUserArenaChunkToFault *[]runtime.stackfreelist *runtime.persistentAlloc *[2][2]*runtime.traceBuf *runtime.pcvalueCacheEnt *map.group[string]uint16 *dnsmessage.AAAAResource *tls.QUICEncryptionLevel PreferServerCipherSuites EncryptedClientHelloKeys *tls.keySharePrivateKeys *tls.certificateMsgTLS13 hashForClientCertificate *tls.newSessionTicketMsg processClientKeyExchange processServerKeyExchange *func([]uint8) hash.Hash *func(int, string) error *textproto.ProtocolError *hpack.InvalidIndexError *json.UnmarshalTypeError github.com/go-chi/chi/v5 *map[string]http.Handler *middleware.hijackWriter *middleware.LogFormatter *jwt.SigningMethodRSAPSS *map.group[string]uint32 *zap.anyFieldC[*float64] *zap.anyFieldC[*float32] *zap.anyFieldC[[]string] *zap.anyFieldC[[]uint64] *zap.anyFieldC[[]uint32] *zap.anyFieldC[[]uint16] *zap.anyFieldC[*uintptr] *mqtt.websocketConnector *mqtt.OpenConnectionFunc SetConnectionLostHandler SetDefaultPublishHandler getConnectionLostHandler *chan mqtt.incomingComms *func(sentry.Frame) bool *zapsentry.FrameMatchers *zapsentry.Configuration *zapcore.ObjectMarshaler *func(string, complex64) *func(string, time.Time) *[][4096]zapcore.counter *zapcore.DurationEncoder *func(time.Time, string) *x509.SignatureAlgorithm *x509.PublicKeyAlgorithm *[]asn1.ObjectIdentifier InhibitPolicyMappingZero *[]*x509.policyGraphNode *map[string]baggage.Item *func() crypto.PublicKey ClientEarlyTrafficSecret *flate.CorruptInputError *func(*flate.compressor) *func([]uint8, []uint32) *[16384]flate.tableEntry probablyPrimeMillerRabin *packets.SubscribePacket *websocket.messageReader *websocket.messageWriter *websocket.netDialerFunc *websocket.writePoolData Critical asn1:"optional" *httputil.delegateReader montgomeryRepresentation *func() (time.Time, bool) *func(bool, error, error) *context.withoutCancelCtx *func(func()) func() bool IsInterfaceLocalMulticast *func() (net.Conn, error) *net.result[[]net.IPAddr] *net.result[go.shape.int] *http.http2WriteScheduler *func() *http.http2Framer *func(time.Duration) bool MaxDecoderHeaderTableSize MaxEncoderHeaderTableSize MaxReceiveBufferPerStream *map[*http.conn]struct {} *http.http2bufferedWriter *http.http2responseWriter *http.http2RSTStreamFrame newWriterAndRequestNoBody promoteUndeclaredTrailers *http.readWriteCloserBody *http.finishAsyncByteRead *map[string]http.muxEntry *http.http2writeQueuePool *http.http2ClientConnPool *chan http.requestAndChan currentRequestCountLocked *http.http2clientConnPool *http.nothingWrittenError *syscall.RawSockaddrInet4 *syscall.RawSockaddrInet6 *syscall.NetlinkRouteAttr *func(interface {}) error *map[string]agent.Command SitePath json:"site_path" ThreadID json:"thread_id" *func() map[string]string *sentry.TransactionSource SetDynamicSamplingContext *sentry.serializedCheckIn *func() *abi.UncommonType *func(int) reflect.Method *func(reflect.Value) bool *[]*runtime.PanicNilError *[4]runtime.stackfreelist *runtime.gcMarkWorkerMode *runtime.traceBlockReason *[10]runtime.heldLockInfo *runtime.gcStatsAggregate *map[int32]unsafe.Pointer *map[unsafe.Pointer]int32 *chan singleflight.Result *tls.RenegotiationSupport unmarshalHandshakeMessage *tls.certificateVerifyMsg *tls.certificateStatusMsg *tls.serverKeyExchangeMsg *tls.clientKeyExchangeMsg generateClientKeyExchange generateServerKeyExchange *func() *nistec.P384Point *func() *nistec.P521Point *func() *nistec.P256Point *tls.clientHandshakeState *base64.CorruptInputError *[]json.reflectWithString *map[chi.methodTyp]string *map[string]chi.methodTyp *jwt.SigningMethodEd25519 *func() jwt.SigningMethod *zap.anyFieldC[complex64] *zap.anyFieldC[[]float64] *zap.anyFieldC[[]float32] *zap.anyFieldC[[]uintptr] *zap.anyFieldC[time.Time] *func(zapcore.Level) bool *func() *zap.errArrayElem *func() *stacktrace.Stack *mqtt.ClientOptionsReader *mqtt.CredentialsProvider SetCustomOpenConnectionFn EnvironmentOverrideColors *zapcore.multiWriteSyncer *func(string, complex128) *zapcore.CheckWriteAction *zapcore.SamplingDecision *zapcore.ReflectedEncoder *zapcore.MapObjectEncoder *map[zapcore.Level]string RequireExplicitPolicyZero *func() *nistec.P224Point asn1:"explicit,tag:1" getWithoutKeySmallFastStr EarlyExporterMasterSecret *encoding.TextUnmarshaler *map[*syntax.Regexp]int64 *packets.DisconnectPacket *pkix.AlgorithmIdentifier *buildcfg.ExperimentFlags *func() []language.Region *func() []language.Script *func([]uint8) *hmac.HMAC *map.group[string][]uint8 *func() []profile.decoder *map.group[string][]int64 *func(string) (int, error) *func(string) net.sockaddr *net.tcpConnWithoutWriteTo *func(func(uintptr)) error *map.group[string][]string *map[string]map[string]int maybeServeUnencryptedHTTP2 *http.http2readFrameResult *http.http2writeResHeaders closeAllStreamsOnConnClose *func([]uint8, int) string *http.expectContinueReader *http.globalOptionsHandler StrictMaxConcurrentStreams *http.http2ConnectionError *http.http2handlerPanicRST *http.http2goAwayFlowError *http.checkConnErrorWriter *http.http2stickyErrWriter *http.requestBodyReadError *map[http.ConnState]string *map[string][]*http.Cookie *strings.appendSliceWriter *syscall.SockaddrLinklayer GidMappingsEnableSetgroups Timestamp json:"timestamp" Vars json:"vars,omitempty" Name json:"name,omitempty" Type json:"type,omitempty" Data json:"data,omitempty" Arch json:"arch,omitempty" UUID json:"uuid,omitempty" *sentry.profileTransaction Tags json:"tags,omitempty" Dist json:"dist,omitempty" User json:"user,omitempty" *sentry.modulesIntegration *map[abi.TypeOff]*abi.Type *[0]*runtime.PanicNilError *[]runtime.pcvalueCacheEnt *runtime.sysStatsAggregate *runtime.cpuStatsAggregate *runtime.sliceInterfacePtr *runtime.debugCallWrapArgs NegotiatedProtocolIsMutual handlePostHandshakeMessage quicGetTransportParameters quicSetTransportParameters *tls.certificateRequestMsg *json.UnsupportedTypeError *func(int) regexp.lazyFlag *func(*regexp.Regexp) bool FindAllStringSubmatchIndex *zap.anyFieldC[complex128] *zap.anyFieldC[*complex64] *zap.anyFieldC[*time.Time] *chan *mqtt.PacketAndToken *<-chan mqtt.incomingComms github.com/sirupsen/logrus *func(*logrus.Entry) error *zapcore.lockedWriteSyncer *zapcore.sliceArrayEncoder *zapcore.appendTimeEncoder *func(string) (int32, int) Hash asn1:"explicit,tag:0" *profilerecord.StackRecord *mlkem.DecapsulationKey768 *func(*flate.decompressor) *packets.UnsubscribePacket *websocket.httpProxyDialer Parameters asn1:"optional" *chan exec.goroutineStatus isCaseIgnorableAndNotCased golang.org/x/text/language *map.group[string][2]int32 *go.shape.map[string]int32 *func(int) *pprof.labelMap *map[string]*pprof.Profile *map[uintptr]pprof.locInfo golang.org/x/text/internal *map.group[[11]uint8]int16 *edwards25519.incomparable *atomic.Pointer[os.dirInfo] *func() (int32, int, error) *func([]uint8) (int, error) *net.tcpConnWithoutReadFrom *map[string][]net.nssSource *net._Ctype_struct_addrinfo *net._Ctype_struct_sockaddr *<-chan singleflight.Result *http.http2frameWriteResult *chan http.http2bodyReadMsg *http.http2unstartedHandler initialStreamSendWindowSize initialStreamRecvWindowSize *http.http2MetaHeadersFrame *http.http2startPushRequest possiblyConflictingPatterns *func(string, http.Handler) *chan http.responseAndError *http.http2PushPromiseFrame *http.http2writePushPromise *http.http2writeSettingsAck *http.http2flushFrameWriter *http.http2connectionStater *func() tls.ConnectionState *func() http.ResponseWriter *map[http.http2Flags]string *http.socksUsernamePassword *go.shape.[]go.shape.string *strings.byteStringReplacer *syscall.RawSockaddrNetlink *func(string, int, int) int *map.group[string]struct {} *map.group[string]time.Time *pool.Pool[go.shape.*uint8] *sentry.checkInScheduleType *sentry.transactionProfiler *func(sentry.ClientOptions) integrationAlreadyInstalled *map.group[string][][]uint8 *reflect.structTypeUncommon *map[*abi.Type]interface {} *[8]runtime.pcvalueCacheEnt *runtime.errorAddressString *runtime.gcBgMarkWorkerNode *runtime.heapStatsAggregate *runtime.stringInterfacePtr *runtime.uint16InterfacePtr *runtime.uint32InterfacePtr *runtime.uint64InterfacePtr *runtime.TypeAssertionError *runtime.traceAdvancerState *poll.DeadlineExceededError *chan<- singleflight.Result SignedCertificateTimestamps *tls.CertificateRequestInfo DynamicRecordSizingDisabled *tls.encryptedExtensionsMsg *map.group[tls.alert]string *map.group[x509.sum224]bool *httptrace.WroteRequestInfo SetMaxDynamicTableSizeLimit parseDynamicTableSizeUpdate *json.UnsupportedValueError *json.InvalidUnmarshalError *map[interface {}]struct {} *map.group[reflect.Type]int *middleware.httpFancyWriter *middleware.LoggerInterface *middleware.defaultLogEntry *middleware.ctxKeyRequestID Issuer json:"iss,omitempty" *map[uint32]*fsnotify.watch *zap.anyFieldC[*complex128] *zap.anyFieldC[[]complex64] *zap.anyFieldC[[]time.Time] *mqtt.ConnectionLostHandler SetConnectionAttemptHandler *func(...string) mqtt.Token *chan packets.ControlPacket *map[logrus.fieldKey]string *func([]uint8) (int32, int) UnhandledCriticalExtensions PermittedDNSDomainsCritical *x509.UnknownAuthorityError crypto/internal/fips140/aes *tls13.ExporterMasterSecret *func(io.Writer, int) error golang.org/x/sync/semaphore *websocket.flateReadWrapper golang.org/x/text/transform *asn1.invalidUnmarshalError *func([]uint8, []uint8) int *pkix.AttributeTypeAndValue *httputil.failureToReadBody *map.group[token.Token]bool crypto/internal/fips140/rsa vendor/golang.org/x/sys/cpu *map[uint64]profile.mapInfo *map[interface {}][]uintptr *map.group[language.Tag]int VarTimeDoubleScalarBaseMult **net._Ctype_struct_addrinfo *map.group[string]net.byName *func(context.Context, bool) *http.http2OpenStreamOptions *http.http2FrameWriteRequest *func(*http.http2serverConn) PermitProhibitedCipherSuites MaxUploadBufferPerConnection *map[*net.Listener]struct {} DisableGeneralOptionsHandler *func(context.Context) error shouldConfigureHTTP2ForServe *http.http2WindowUpdateFrame copyTrailersToHandlerRequest shouldSendChunkedRequestBody *func(*http.http2ClientConn) *map[[8]uint8]chan struct {} awaitOpenSlotForStreamLocked decrStreamReservationsLocked *func() (fs.FileInfo, error) *http.http2writeWindowUpdate *http.http2pseudoHeaderError *http.http2ContinuationFrame *http.http2noCachedConnError *func([]uint8, int, int) int Colno json:"colno,omitempty" Level json:"level,omitempty" Email json:"email,omitempty" Value json:"value,omitempty" Extra json:"extra,omitempty" Spans json:"spans,omitempty" findNearbySourceCodeLocation CheckInID json:"check_in_id" *interface { Cause() error } Trace json:"trace,omitempty" *func(reflectlite.Type) bool *map[*reflect.structType]int *map.group[reflect.Type]bool *go.shape.*internal/abi.Type *runtime.savedOpenDeferState *[]profilerecord.StackRecord *map[dnsmessage.Class]string *map[dnsmessage.RCode]string *func(string, string, error) SupportedSignatureAlgorithms *map[string]*tls.Certificate *tls.EncryptedClientHelloKey supportedSignatureAlgorithms secureRenegotiationSupported *multipart.stickyErrorReader crypto/internal/fips140/drbg *func(httptrace.GotConnInfo) *func(httptrace.DNSDoneInfo) vendor/golang.org/x/net/idna *middleware.http2FancyWriter *func(interface {}, []uint8) github.com/golang-jwt/jwt/v5 *jwt.unsafeNoneMagicConstant Subject json:"sub,omitempty" github.com/fsnotify/fsnotify *zap.anyFieldC[[]complex128] *zap.anyFieldC[fmt.Stringer] *zap.anyFieldC[interface {}] github.com/gorilla/websocket *chan *packets.PublishPacket *<-chan *mqtt.PacketAndToken *func(packets.ControlPacket) *func(string, time.Duration) *func() *zapcore.jsonEncoder *x509.InsecureAlgorithmError *func(crypto.PublicKey) bool *map.group[string][]x509.OID ClientHandshakeTrafficSecret ServerHandshakeTrafficSecret crypto/internal/fips140/ecdh *map[string]syntax.charGroup *map.group[string]*flag.Flag *websocket.flateWriteWrapper *map.group[string]func(bool) *ecdsa.personalizationString crypto/internal/fips140/hmac crypto/internal/fips140/sha3 *map[uint64]*profile.Mapping *internal.InheritanceMatcher *interface { Is(error) bool } *interface { Unwrap() error } *func() ([]net.IPAddr, error) *func() (go.shape.int, error) *func() http.http2FrameHeader MaxReceiveBufferPerConnection *map[uint32]*http.http2stream *[]http.http2unstartedHandler startGracefulShutdownInternal *map[string]*http.routingNode *http.http2transportTestHooks *http.http2erringRoundTripper *http.unencryptedHTTP2Request *map[http.http2ErrCode]string *map[http.http2SettingID]bool *map[string]http.RoundTripper *strings.singleStringReplacer *syscall.RawSockaddrLinklayer ReporterID json:"reporter_id" go.uber.org/zap/internal/pool *sentry.profileThreadMetadata *sentry.globalTagsIntegration *map[*reflect.structType]bool *map.group[reflect.visit]bool *[][8]runtime.pcvalueCacheEnt *map.group[uint32][]*abi.Type *interface { Timeout() bool } *[]chan<- singleflight.Result *func() (interface {}, error) *tls.newSessionTicketMsgTLS13 *func() *elliptic.CurveParams *map[string]map[string]string *func(httptrace.DNSStartInfo) SetAllowedMaxDynamicTableSize *map.group[string]*json.field *middleware.flushHijackWriter Audience json:"aud,omitempty" IssuedAt json:"iat,omitempty" *zap.anyFieldC[time.Duration] *mqtt.connectionLostHandledFn *<-chan packets.ControlPacket *func() *zapcore.CheckedEntry *func() *zapcore.errArrayElem *func(*buffer.Buffer, string) *x509.CertificateInvalidError *[]pkix.AttributeTypeAndValue crypto/internal/fips140/ecdsa crypto/internal/fips140/mlkem crypto/internal/fips140/tls13 *map.group[pprof.handler]bool *map.group[*syntax.Regexp]int *map.group[string]token.Token isNotCasedAndNotCaseIgnorable *map[string]language.Language *go.shape.map[string][2]int32 *map[uint64]*profile.Function *map[uint64]*profile.Location *context.deadlineExceededError *chan net.result[[]net.IPAddr] *chan net.result[go.shape.int] *http.http2responseWriterState *func(string, ...interface {}) *http.http2serverInternalState *func() (io.ReadCloser, error) onceSetNextProtoDefaults_Serve *[]http.http2FrameWriteRequest *map[http.connectMethodKey]int *func(*http.http2clientStream) *http.tlsHandshakeTimeoutError *func(*url.URL) []*http.Cookie *map.group[string]interface {} Symbol json:"symbol,omitempty" Module json:"module,omitempty" Lineno json:"lineno,omitempty" github.com/getsentry/sentry-go Frames json:"frames,omitempty" Method json:"method,omitempty" Source json:"source,omitempty" Images json:"images,omitempty" *sentry.DynamicSamplingContext Transaction json:"transaction" Status json:"status,omitempty" Logger json:"logger,omitempty" *sentry.environmentIntegration *map[interface {}]interface {} *func(int) reflect.StructField *[2][8]runtime.pcvalueCacheEnt *map[string]runtime.metricData *struct { F uintptr; X0 bool } *map[dnsmessage.section]string *map[string]*singleflight.call *[1]chan<- singleflight.Result *[]tls.EncryptedClientHelloKey EncryptedClientHelloConfigList *func(*big.Int, *big.Int) bool *func(uint16) tls.keyAgreement *map.group[string]http.Handler *middleware.WrapResponseWriter *func(*regexp.Regexp, int) int ExpiresAt json:"exp,omitempty" NotBefore json:"nbf,omitempty" *zap.anyFieldC[*time.Duration] *mqtt.ConnectionAttemptHandler *<-chan *packets.PublishPacket *zapcore.PrimitiveArrayEncoder *func(*buffer.Buffer, []uint8) *map[zapcore.Level]color.Color *x509.ConstraintViolationError *map.group[string]baggage.Item ClientApplicationTrafficSecret ServerApplicationTrafficSecret *func(io.Reader) io.ReadCloser *struct { key int; elem bool } *transform.SpanningTransformer go.uber.org/zap/internal/color *[1]pkix.AttributeTypeAndValue crypto/internal/fips140/nistec crypto/internal/fips140/bigmod crypto/internal/fips140/sha256 crypto/internal/fips140/sha512 *map[context.canceler]struct {} *interface { Unwrap() []error } *func([]uint8) ([]uint8, error) *func(io.Writer) (int64, error) *func(io.Reader) (int64, error) *func(func(uintptr) bool) error *map[net.hostLookupOrder]string *func(net.Conn, http.ConnState) *map.group[*http.conn]struct {} *chan http.http2readFrameResult processSettingInitialWindowSize *map.group[string]http.muxEntry *http.http2noDialH2RoundTripper *http.http2noDialClientConnPool *map[string]*http.http2dialCall *http.http2unencryptedTransport *http.http2headerFieldNameError *map[http.http2FrameType]string *map[http.http2SettingID]string *func(*url.URL, []*http.Cookie) *struct { F uintptr; X0 error } *map.group[string]agent.Command MessageType json:"message_type" *map[logrus.Level][]logrus.Hook ExceptionID json:"exception_id" CodeID json:"code_id,omitempty" BuildNumber json:"build_number" MonitorSlug json:"monitor_slug" *sentry.ignoreErrorsIntegration *atomic.Pointer[runtime._defer] *runtime.metricFloat64Histogram *func(uintptr) (uintptr, int64) *map.group[int32]unsafe.Pointer *map.group[unsafe.Pointer]int32 *tls.certificateRequestMsgTLS13 *interface { Temporary() bool } *map[hpack.pairNameValue]uint64 *map[string]*unicode.RangeTable *internal.FlushAfterChunkWriter *func(*json.scanner, uint8) int *func(string, http.HandlerFunc) *map.group[chi.methodTyp]string *map.group[string]chi.methodTyp *middleware.DefaultLogFormatter *zap.anyFieldC[[]time.Duration] Level json:"level" yaml:"level" *map[uint16]mqtt.tokenCompletor *map[string]*mqtt.backoffStatus *map.group[zapcore.Level]string *map[*x509.policyGraphNode]bool *profilerecord.MemProfileRecord crypto/internal/fips140/aes/gcm *func([]uint8) cipher.BlockMode *func(io.Reader, []uint8) error *func(*norm.reorderBuffer) bool *map.group[*syntax.Regexp]int64 *func([]uintptr, []uintptr) int golang.org/x/net/internal/socks *func(interface {}) interface {} *func() (syscall.RawConn, error) *struct { key int; elem string } *struct { key string; elem int } *map.group[string]map[string]int *struct { F uintptr; X0 string } *func() http.http2WriteScheduler *chan http.http2frameWriteResult *http.http2transportResponseBody *http.http2headerFieldValueError *http.http2headersOrContinuation *struct { io.Reader; io.Closer } *map.group[http.ConnState]string *map.group[string][]*http.Cookie *func(http.Handler) http.Handler Package json:"package,omitempty" Message json:"message,omitempty" Version json:"version,omitempty" Crashed json:"crashed,omitempty" Current json:"current,omitempty" Segment json:"segment,omitempty" Cookies json:"cookies,omitempty" Headers json:"headers,omitempty" Handled json:"handled,omitempty" Architecture json:"architecture" Manufacturer json:"manufacturer" StartTime json:"start_timestamp" Release json:"release,omitempty" Threads json:"threads,omitempty" Modules json:"modules,omitempty" Request json:"request,omitempty" *struct { F uintptr; X0 []int8 } *func([]int) reflect.StructField *map.group[abi.TypeOff]*abi.Type *runtime.traceSchedResourceState *map[runtime._typePair]struct {} *nettrace.LookupIPAltResolverKey *func(tls.ConnectionState) error *func([]uint8, []uint8) tls.aead supportedSignatureAlgorithmsCert *map[uint16]func() *hpke.hkdfKDF *httptrace.clientEventContextKey *map[chi.methodTyp]*chi.endpoint *func(zapcore.Core) zapcore.Core *func() mqtt.ClientOptionsReader *interface { TypeName() string } *func([]*x509.Certificate) error *x509.UnhandledCriticalExtension SaltLength asn1:"explicit,tag:2" *chacha8rand.errUnmarshalChaCha8 *[]struct { key int; elem bool } *map.group[string]*pprof.Profile *map[uintptr]*pprof.profMapEntry *map.group[uintptr]pprof.locInfo !*map.group[string][]net.nssSource !*struct { key uint64; elem bool } !*http.http2synctestGroupInterface !*struct { key string; elem bool } !*chan http.http2FrameWriteRequest !*http.unencryptedNetConnInTLSConn !*map[uint32]*http.http2writeQueue !*map.group[http.http2Flags]string !*struct { F uintptr; X0 []uint8 } !*func() (jwt.ClaimStrings, error) !*func() (*jwt.NumericDate, error) AbsPath json:"abs_path,omitempty" SdkName json:"sdk_name,omitempty" DebugID json:"debug_id,omitempty" SdkInfo json:"sdk_info,omitempty" EventID json:"event_id,omitempty" CheckIn json:"check_in,omitempty" !*struct { F uintptr; X0 []int16 } !*struct { F uintptr; X0 []int32 } !*struct { F uintptr; X0 []int64 } !*map.group[*abi.Type]interface {} !*[]profilerecord.MemProfileRecord !initLegacySessionTicketKeyRLocked !*tls.CertificateVerificationError !*struct { key uint16; elem bool } !*func(tls.ConnectionState, error) !*func(httptrace.WroteRequestInfo) !*map.group[interface {}]struct {} !*func(json.field, json.field) int !*struct { F uintptr; R *chi.Mux } !*map.group[uint32]*fsnotify.watch !*func(zapcore.ArrayEncoder) error !*func(*url.URL) (zap.Sink, error) !*map[string]packets.ControlPacket !*func(uint16) mqtt.tokenCompletor !*struct { key uint8; elem error } !*map.group[logrus.fieldKey]string !github.com/TheZeroSlave/zapsentry !*func(string, interface {}) error !*func(time.Duration) *time.Ticker !*func(*x509.policyGraphNode) bool !*map[string]*x509.policyGraphNode !*map[ratelimit.Category]struct {} !*profilerecord.BlockProfileRecord !*func([]uint8, bool) (int, error) !*func(*flag.Flag, *flag.Flag) int !*[8]struct { key int; elem bool } !*struct { in string; out string } !*ecdsa.plainPersonalizationString !*map.group[uint64]profile.mapInfo !*map.group[interface {}][]uintptr "*atomic.Pointer[net/http.response] "*atomic.Pointer[sync.poolChainElt] "*func(*net.Buffers) (int64, error) "*[]struct { key int; elem string } "*[]struct { key string; elem int } "*net.result[go.shape.[]net.IPAddr] "*func(http.http2FrameWriteRequest) "*map.group[*net.Listener]struct {} "*struct { io.Reader; io.WriterTo } "*map.group[[8]uint8]chan struct {} "*map[string]*http.http2addConnCall "*http.transportReadFromServerError "*struct { F uintptr; R *tls.Conn } "*struct { F uintptr; X0 []string } "*struct { F uintptr; X0 net.Conn } "*[]func(http.Handler) http.Handler Username json:"username,omitempty" Function json:"function,omitempty" Filename json:"filename,omitempty" Platform json:"platform,omitempty" Priority json:"priority,omitempty" "*func() sentry.checkInScheduleType Category json:"category,omitempty" Packages json:"packages,omitempty" ParentSpanID json:"parent_span_id" Duration json:"duration,omitempty" Schedule json:"schedule,omitempty" Timezone json:"timezone,omitempty" Contexts json:"contexts,omitempty" "*map.group[*reflect.structType]int "*struct { runtime.gList; n int32 } "*struct { F uintptr; X0 chan int } "*map.group[dnsmessage.Class]string "*map.group[dnsmessage.RCode]string "*func([]interface {}, bool, error) "*func() (*x509.Certificate, error) "*map.group[string]*tls.Certificate "*struct { key string; elem []int } "*func(string, string, net.IP) bool "*func(func(chi.Router)) chi.Router "*func(zapcore.ObjectEncoder) error "*struct { key string; elem uint8 } "*func(string, mqtt.MessageHandler) "*struct { key uint8; elem string } "*func() *zapcore.sliceArrayEncoder Layout json:"layout" yaml:"layout" "*chacha20poly1305.chacha20poly1305 "*struct { key uint32; elem int32 } "*map.group[string]syntax.charGroup "*pkix.RelativeDistinguishedNameSET "*struct { key string; elem int32 } "*map.group[uint64]*profile.Mapping #*[8]struct { key int; elem string } #*[8]struct { key string; elem int } #*[]struct { key uint64; elem bool } #*func(http.http2writeContext) error #*[]struct { key string; elem bool } #*struct { key string; elem string } #*func(net.Listener) context.Context #*map.group[uint32]*http.http2stream #*map.group[string]*http.routingNode #*http.http2roundRobinWriteScheduler #*map[uint32]*http.http2clientStream #*map[string][]*http.http2ClientConn #*map[*http.http2ClientConn][]string #*http.http2clientConnPoolIdleCloser #*map.group[http.http2ErrCode]string #*map.group[http.http2SettingID]bool #*map[string][]*multipart.FileHeader #*map.group[string]http.RoundTripper #*struct { F uintptr; X0 *tls.Conn } #*struct { F uintptr; X0 time.Time } #*func(fs.DirEntry, fs.DirEntry) int #*struct { key string; elem uint64 } #*[1]func(http.Handler) http.Handler SitePath json:"site_path,omitempty" #*map[string]map[string]interface {} AddrMode json:"addr_mode,omitempty" HelpLink json:"help_link,omitempty" ParentID json:"parent_id,omitempty" ThreadID json:"thread_id,omitempty" CodeFile json:"code_file,omitempty" #*sentry.contextifyFramesIntegration #*map.group[*reflect.structType]bool #*struct { F uintptr; X0 *abi.Type } #*weak.Pointer[net/netip.addrDetail] #*func(*abi.Type, interface {}) bool #*func(interface {}, uintptr, int64) #*[]profilerecord.BlockProfileRecord #*struct { key string; elem uint16 } #EncryptedClientHelloRejectionVerify #*func([]uint8) (*big.Int, *big.Int) #*[]struct { key uint16; elem bool } #*func([]uint8) (cipher.AEAD, error) #*map.group[string]map[string]string #vendor/golang.org/x/net/http2/hpack #*func(string, string, http.Handler) #github.com/go-chi/chi/v5/middleware #*struct { key string; elem uint32 } #github.com/eclipse/paho.mqtt.golang #*func(string) packets.ControlPacket #*[]struct { key uint8; elem error } #*func([]zapcore.Field) zapcore.Core #*func(zapcore.ArrayMarshaler) error #*map[string][]*x509.policyGraphNode #*[]map[string]*x509.policyGraphNode #go.uber.org/zap/internal/stacktrace #*map.group[string]language.Language #*map.group[uint64]*profile.Function #*map.group[uint64]*profile.Location #*struct { F uintptr; X0 io.Writer } #golang.org/x/text/internal/language #crypto/internal/fips140/nistec/fiat $*unique.Handle[net/netip.addrDetail] $*interface { As(interface {}) bool } $*func(int) (syscall.Sockaddr, error) $*[8]struct { key uint64; elem bool } $*map[*http.http2serverConn]struct {} $*[8]struct { key string; elem bool } $*map[*http.persistConn]*list.Element $*map.group[http.connectMethodKey]int $*struct { F uintptr; R *net.Dialer } $*struct { F uintptr; X0 chan error } $*struct { F uintptr; R *api.Server } Mechanism json:"mechanism,omitempty" Classification json:"classification" Exception json:"exception,omitempty" Timestamp json:"timestamp,omitempty" $*map.group[interface {}]interface {} $*func(string) (reflect.Method, bool) $*runtime.goroutineProfileStateHolder $*map.group[string]runtime.metricData $*map.group[dnsmessage.section]string $*map.group[string]*singleflight.call $*[]struct { key string; elem []int } $*[8]struct { key uint16; elem bool } $*struct { F uintptr; R crypto.Hash } $*map[string]func() jwt.SigningMethod $*[]struct { key string; elem uint8 } $*func(string, packets.ControlPacket) $*[8]struct { key uint8; elem error } $*[]struct { key uint8; elem string } $*func(string) ([]fs.FileInfo, error) $*func(zapcore.ObjectMarshaler) error $*map.group[zapcore.Level]color.Color $*[1]map[string]*x509.policyGraphNode $*func(string, string) (string, bool) $*func(string) (io.ReadCloser, error) $*func(int, int) (cipher.AEAD, error) $*[]struct { key uint32; elem int32 } $*struct { F uintptr; R buffer.Pool } $*struct { key string; elem []uint8 } $*[]struct { key string; elem int32 } $*struct { key string; elem []int64 } $crypto/internal/fips140/edwards25519 %*map.group[context.canceler]struct {} %*func([]uint8) (int, net.Addr, error) %*func([]uint8, net.Addr) (int, error) %*map.group[net.hostLookupOrder]string %*struct { key string; elem []string } %*struct { F uintptr; X0 *time.Timer } %*[]struct { key string; elem string } %*map.group[string]*http.http2dialCall %*http.http2duplicatePseudoHeaderError %*map.group[http.http2FrameType]string %*map.group[http.http2SettingID]string %*struct { F uintptr; R http.Handler } %*struct { F uintptr; R *atomic.Bool } %*map[chan<- os.Signal]*signal.handler %*func(io.Writer, string) (int, error) %*[]struct { key string; elem uint64 } RequestID json:"request_id,omitempty" %*map.group[logrus.Level][]logrus.Hook ImageAddr json:"image_addr,omitempty" ThreadMetadata json:"thread_metadata" IPAddress json:"ip_address,omitempty" ImageSize json:"image_size,omitempty" DebugFile json:"debug_file,omitempty" DebugMeta json:"debug_meta,omitempty" %*sentry.ignoreTransactionsIntegration %*sync.node[interface {},interface {}] %*[]struct { key string; elem uint16 } %*[8]struct { key string; elem []int } %*map.group[hpack.pairNameValue]uint64 %*map.group[string]*unicode.RangeTable %*struct { ptr interface {}; len int } %*[]struct { key string; elem uint32 } Initial json:"initial" yaml:"initial" %*struct { F uintptr; X0 *zap.Logger } %*[8]struct { key string; elem uint8 } %*map.group[uint16]mqtt.tokenCompletor %*map.group[string]*mqtt.backoffStatus %*[8]struct { key uint8; elem string } %*func(*logrus.Entry) ([]uint8, error) TimeKey json:"timeKey" yaml:"timeKey" NameKey json:"nameKey" yaml:"nameKey" NewReflectedEncoder json:"-" yaml:"-" %*map.group[*x509.policyGraphNode]bool %vendor/golang.org/x/crypto/cryptobyte %*func(*flate.compressor, []uint8) int %vendor/golang.org/x/text/unicode/norm %*[8]struct { key uint32; elem int32 } %*[8]struct { key string; elem int32 } %*struct { key string; elem [2]int32 } %*struct { key [11]uint8; elem int16 } &*atomic.Pointer[internal/bisect.dedup] &*func() (go.shape.[]net.IPAddr, error) &*struct { F uintptr; R *net.Resolver } &*func(uint32, http.http2PriorityParam) &*[8]struct { key string; elem string } &*func(string, *http.PushOptions) error &*func(*http.Request) (*url.URL, error) &*func(int, textproto.MIMEHeader) error &*http.http2bufferedWriterTimeoutWriter &*struct { F uintptr; X0 bytes.Reader } &*struct { F uintptr; X0 http.Handler } &*go.shape.interface { Error() string } &*[8]struct { key string; elem uint64 } &*struct { key string; elem struct {} } &*struct { key string; elem time.Time } Stacktrace json:"stacktrace,omitempty" ActiveThreadID json:"active_thread_id" &*struct { key string; elem [][]uint8 } &*sync.entry[interface {},interface {}] &*func(interface {}, interface {}) bool &*func([]reflect.Value) []reflect.Value &*func(*runtime.g, unsafe.Pointer) bool &*map.group[runtime._typePair]struct {} &vendor/golang.org/x/net/dns/dnsmessage &*[8]struct { key string; elem uint16 } &*func(string, *tls.ClientSessionState) &*tls.handshakeMessageWithOriginalBytes &*struct { key tls.alert; elem string } &*struct { key x509.sum224; elem bool } &*map.group[uint16]func() *hpke.hkdfKDF &vendor/golang.org/x/net/http/httpproxy &*struct { key reflect.Type; elem int } &*map.group[chi.methodTyp]*chi.endpoint &*[8]struct { key string; elem uint32 } &*struct { F uintptr; X0 *[]io.Closer } &*func(*runtime.Frame) (string, string) &*struct { F uintptr; X0 zapcore.Core } &*struct { F uintptr; R *flag.FlagSet } &*struct { F uintptr; X0 proxy.Dialer } &*struct { F uintptr; R reflect.Value } &*struct { key token.Token; elem bool } &*[]struct { key string; elem []uint8 } &*[]struct { key string; elem []int64 } &*map[profile.sampleKey]*profile.Sample &*map.group[uintptr]*pprof.profMapEntry &*struct { key language.Tag; elem int } &*fiat.p224MontgomeryDomainFieldElement &*fiat.p384MontgomeryDomainFieldElement &*fiat.p521MontgomeryDomainFieldElement '*atomic.Pointer[internal/godebug.value] '*[]struct { key string; elem []string } '*struct { key string; elem net.byName } '*func(string, string) (net.Conn, error) '*chan net.result[go.shape.[]net.IPAddr] '*func() (*hpack.Encoder, *bytes.Buffer) '*map.group[uint32]*http.http2writeQueue '*http.http2write100ContinueHeadersFrame PreContext json:"pre_context,omitempty" SymbolAddr json:"symbol_addr,omitempty" StackStart json:"stack_start,omitempty" DurationNS json:"duration_ns,omitempty" MaxRuntime json:"max_runtime,omitempty" ServerName json:"server_name,omitempty" '*map[sentry.TransactionSource]struct {} '*struct { key reflect.Type; elem bool } '*unique.uniqueMap[net/netip.addrDetail] '*struct { F uintptr; R *atomic.Uint64 } '*func(string, string, http.HandlerFunc) '*func(string, ...fsnotify.addOpt) error '*map.group[string]packets.ControlPacket '*zapsentry.SkipModulePrefixFrameMatcher '*iter.Seq[*crypto/x509.policyGraphNode] '*func(func(*x509.policyGraphNode) bool) '*map.group[string]*x509.policyGraphNode '*struct { key string; elem []x509.OID } '*struct { F uintptr; X0 *bytes.Buffer } '*map.group[ratelimit.Category]struct {} '*func([]uint8) (*ecdh.PublicKey, error) '*struct { key string; elem *flag.Flag } '*struct { key string; elem func(bool) } '*struct { F uintptr; X0 cases.mapFunc } '*[8]struct { key string; elem []uint8 } '*[]struct { key string; elem [2]int32 } '*[8]struct { key string; elem []int64 } '*[]struct { key [11]uint8; elem int16 } (*[8]struct { key string; elem []string } (*struct { F uintptr; X0 chan struct {} } (*map.group[string]*http.http2addConnCall (*struct { F uintptr; X0 strings.Reader } (*[]struct { key string; elem struct {} } (*[]struct { key string; elem time.Time } Description json:"description,omitempty" Environment json:"environment,omitempty" Breadcrumbs json:"breadcrumbs,omitempty" Fingerprint json:"fingerprint,omitempty" Transaction json:"transaction,omitempty" (*[]struct { key string; elem [][]uint8 } (*[]*sync.node[interface {},interface {}] (*struct { key reflect.visit; elem bool } (*struct { key uint32; elem []*abi.Type } (*[]struct { key tls.alert; elem string } (*[]struct { key x509.sum224; elem bool } (*struct { key string; elem *json.field } (*[]struct { key reflect.Type; elem int } (*struct { F uintptr; R json.mapEncoder } (*struct { F uintptr; R json.ptrEncoder } (*func(*chi.Context, string, string) bool (*func(*http.Request) middleware.LogEntry Sampling json:"sampling" yaml:"sampling" Encoding json:"encoding" yaml:"encoding" LevelKey json:"levelKey" yaml:"levelKey" (*map[platform.OSArch]platform.osArchInfo (*func([]uint8) (*ecdh.PrivateKey, error) (*struct { key pprof.handler; elem bool } (*struct { key *syntax.Regexp; elem int } (*struct { key string; elem token.Token } (*[]struct { key token.Token; elem bool } (*struct { F uintptr; X0 []language.Tag } (*ecdsa.blockAlignedPersonalizationString (*[8]struct { key string; elem [2]int32 } (*map[profile.mappingKey]*profile.Mapping (*[]struct { key language.Tag; elem int } (*[8]struct { key [11]uint8; elem int16 } )*struct { F uintptr; X0 *mqtt.Publisher } )*[]struct { key string; elem net.byName } )*func(http.ResponseWriter, *http.Request) )*http.entry[string,*net/http.routingNode] )*map[http.routingIndexKey][]*http.pattern )*map.group[uint32]*http.http2clientStream )*map.group[string][]*http.http2ClientConn )*map.group[*http.http2ClientConn][]string )*func(http.keyValues, http.keyValues) int )*interface { IsHTTP2NoCachedConnError() } )*map.group[string][]*multipart.FileHeader )*struct { F uintptr; R *http.connReader } )*struct { key string; elem interface {} } )*[8]struct { key string; elem struct {} } )*[8]struct { key string; elem time.Time } )*map.group[string]map[string]interface {} ContextLine json:"context_line,omitempty" PostContext json:"post_context,omitempty" )*map[uint64]*sentry.profileThreadMetadata QueryString json:"query_string,omitempty" ImageVmaddr json:"image_vmaddr,omitempty" )*[8]struct { key string; elem [][]uint8 } )*sync.indirect[interface {},interface {}] )*[]*sync.entry[interface {},interface {}] )*[0]*sync.node[interface {},interface {}] ContentType json:"content_type,omitempty" )*func(string) (reflect.StructField, bool) )*[]struct { key reflect.Type; elem bool } )*func(func(*abi.Type, interface {}) bool) )*struct { F uintptr; R *godebug.Setting } )*[8]struct { key tls.alert; elem string } )*[8]struct { key x509.sum224; elem bool } )*[8]struct { key reflect.Type; elem int } )*struct { key string; elem http.Handler } )*func(...func(http.Handler) http.Handler) )*func(string, interface {}) zapcore.Field )*pool.Pool[*go.uber.org/zap.errArrayElem] )*struct { F uintptr; X0 []zapcore.Field } )*struct { F uintptr; X0 *websocket.Conn } )*func(io.Writer) zapcore.ReflectedEncoder )*map.group[string][]*x509.policyGraphNode )*[]struct { key string; elem []x509.OID } )*struct { key string; elem baggage.Item } )*struct { F uintptr; X0 *int; X1 string } )*[]struct { key string; elem *flag.Flag } )*func(io.WriteCloser, int) io.WriteCloser )*[]struct { key string; elem func(bool) } )*[8]struct { key token.Token; elem bool } )*struct { F uintptr; X0 []language.Base } )*func(*pprof.Profile, *pprof.Profile) int )*[8]struct { key language.Tag; elem int } **[8]struct { key string; elem net.byName } **func(uint32, http.http2OpenStreamOptions) **map.group[*http.http2serverConn]struct {} **struct { key *http.conn; elem struct {} } **struct { key string; elem http.muxEntry } **map.group[*http.persistConn]*list.Element **map[*http.Request]context.CancelCauseFunc **func(string, *tls.Conn) http.RoundTripper **struct { F uintptr; R *http.http2stream } **struct { F uintptr; R *http.persistConn } **struct { F uintptr; R *httpproxy.config } **struct { F uintptr; X0 *http.connReader } **struct { key string; elem agent.Command } **pool.Pool[*go.uber.org/zap/buffer.Buffer] Integrations json:"integrations,omitempty" StartTime json:"start_timestamp,omitempty" **[0]*sync.entry[interface {},interface {}] **func(unsafe.Pointer, unsafe.Pointer) bool **map[ratelimit.Category]ratelimit.Deadline **struct { F uintptr; X0 []unsafe.Pointer } **[8]struct { key reflect.Type; elem bool } **[]struct { key reflect.visit; elem bool } **struct { key int32; elem unsafe.Pointer } **[]struct { key uint32; elem []*abi.Type } **struct { key unsafe.Pointer; elem int32 } **func([]uint8, []uint8, bool) interface {} **struct { F uintptr; X0 func() hash.Hash } **[]struct { key string; elem *json.field } **struct { F uintptr; R json.arrayEncoder } **struct { F uintptr; R json.floatEncoder } **struct { F uintptr; R json.sliceEncoder } **func(*chi.Context, string, string) string **func(string, func(chi.Router)) chi.Router **struct { key chi.methodTyp; elem string } **struct { key string; elem chi.methodTyp } **func(string, []uint8, interface {}) error **map.group[string]func() jwt.SigningMethod **struct { F uintptr; R *zap.sinkRegistry } **struct { key zapcore.Level; elem string } **[8]struct { key string; elem []x509.OID } **struct { sync.Once; v *x509.Certificate } **func(io.Reader) (*ecdh.PrivateKey, error) **[]struct { key pprof.handler; elem bool } **[]struct { key *syntax.Regexp; elem int } **struct { key *syntax.Regexp; elem int64 } **[8]struct { key string; elem *flag.Flag } *vendor/golang.org/x/crypto/cryptobyte/asn1 **[]struct { key string; elem token.Token } **[8]struct { key string; elem func(bool) } *crypto/internal/fips140/edwards25519/field **map[profile.functionKey]*profile.Function **map[profile.locationKey]*profile.Location +*struct { F uintptr; X0 *context.timerCtx } +*struct { key string; elem map[string]int } +*struct { F uintptr; X0 string; X1 string } +*func() (http.http2FrameWriteRequest, bool) +*http.mapping[string,*net/http.routingNode] +*[]http.entry[string,*net/http.routingNode] +*struct { key http.ConnState; elem string } +*struct { key string; elem []*http.Cookie } +*func(*http.Request, []*http.Request) error +*struct { F uintptr; X0 *http.http2Server } +*struct { F uintptr; X0 *http.http2Framer } +*struct { F uintptr; X0 *http.persistConn } +*map.group[chan<- os.Signal]*signal.handler +*[]struct { key string; elem interface {} } +cloudlinux.com/defence360.git/src/proxy/api ReporterIncrement json:"reporter_increment" VersionMajor json:"version_major,omitempty" VersionMinor json:"version_minor,omitempty" +*[8]struct { key reflect.visit; elem bool } +*sync.node[*internal/abi.Type,interface {}] +*struct { key abi.TypeOff; elem *abi.Type } +*[8]struct { key uint32; elem []*abi.Type } +*struct { F uintptr; X0 *x509.Certificate } +*[8]struct { key string; elem *json.field } +*struct { F uintptr; R json.structEncoder } +*[]struct { key string; elem http.Handler } +*struct { F uintptr; X0 *fsnotify.inotify } +*func(zapcore.Entry, []zapcore.Field) error +*func(string, zapcore.ArrayMarshaler) error CallerKey!json:"callerKey" yaml:"callerKey" +*[]struct { key string; elem baggage.Item } +vendor/golang.org/x/crypto/chacha20poly1305 +*[8]struct { key pprof.handler; elem bool } +*[8]struct { key *syntax.Regexp; elem int } +github.com/eclipse/paho.mqtt.golang/packets +*[8]struct { key string; elem token.Token } +golang.org/x/text/internal/language/compact +*struct { F uintptr; X0 []language.Region } +*struct { F uintptr; X0 []language.Script } +*struct { key string; elem *pprof.Profile } +*struct { key uintptr; elem pprof.locInfo } ,*struct { F uintptr; X0 *context.cancelCtx } ,*func(string, string, syscall.RawConn) error ,*struct { key string; elem []net.nssSource } ,*func(*http.Server, *tls.Conn, http.Handler) ,*func() (net.Conn, *bufio.ReadWriter, error) ,*[]struct { key *http.conn; elem struct {} } ,*[]struct { key string; elem http.muxEntry } ,*func(*http.Request) (*http.Response, error) ,*interface { UnencryptedNetConn() net.Conn } ,*struct { key http.http2Flags; elem string } ,*[8]struct { key string; elem interface {} } ,*[]struct { key string; elem agent.Command } ,*struct { F uintptr; R *auth.Authenticator } ,cloudlinux.com/defence360.git/src/proxy/auth MessageReporterID json:"message_reporter_id" ,cloudlinux.com/defence360.git/src/proxy/mqtt ,*sync.HashTrieMap[interface {},interface {}] ,*[]*sync.indirect[interface {},interface {}] ,*func(func(interface {}, interface {}) bool) ParentSpanID json:"parent_span_id,omitempty" ,*sync.entry[*internal/abi.Type,interface {}] ,*struct { key *abi.Type; elem interface {} } ,*struct { len int; buf [128]*runtime.mspan } ,*[]struct { key int32; elem unsafe.Pointer } ,*[]struct { key unsafe.Pointer; elem int32 } ,*func(string, []uint8, int) ([]uint8, error) ,*struct { key interface {}; elem struct {} } ,*[8]struct { key string; elem http.Handler } ,*[]struct { key chi.methodTyp; elem string } ,*[]struct { key string; elem chi.methodTyp } ,*func(string, interface {}) ([]uint8, error) ,*struct { key uint32; elem *fsnotify.watch } ,*map[string]func(*url.URL) (zap.Sink, error) ,*struct { key logrus.fieldKey; elem string } ,*func(string, zapcore.ObjectMarshaler) error ,*[]struct { key zapcore.Level; elem string } ,*[8]struct { key string; elem baggage.Item } ,*[]struct { key *syntax.Regexp; elem int64 } ,*map.group[profile.sampleKey]*profile.Sample ,*struct { key uint64; elem profile.mapInfo } ,*struct { key interface {}; elem []uintptr } -*struct { F uintptr; X0 *auth.SecretManager } -*[]struct { key string; elem map[string]int } -*struct { key *net.Listener; elem struct {} } -*[8]struct { key *http.conn; elem struct {} } -*[8]struct { key string; elem http.muxEntry } -*map[http.connectMethodKey]http.wantConnQueue -*struct { key [8]uint8; elem chan struct {} } -*[]struct { key http.ConnState; elem string } -*[]struct { key string; elem []*http.Cookie } -*func() go.shape.interface { Error() string } -cloudlinux.com/defence360.git/src/proxy/agent -*[8]struct { key string; elem agent.Command } FramesOmitted json:"frames_omitted,omitempty" CheckInMargin json:"checkin_margin,omitempty" MonitorConfig json:"monitor_config,omitempty" -*[0]*sync.indirect[interface {},interface {}] -*map.group[sentry.TransactionSource]struct {} -*func(fmtsort.KeyValue, fmtsort.KeyValue) int -*struct { key *reflect.structType; elem int } -*struct { F uintptr; X0 *reflect.structType } -*[]struct { key abi.TypeOff; elem *abi.Type } -*[8]struct { key int32; elem unsafe.Pointer } -*[8]struct { key unsafe.Pointer; elem int32 } -*struct { F uintptr; R runtime.metricReader } -*struct { key dnsmessage.Class; elem string } -*struct { key dnsmessage.RCode; elem string } -*struct { key string; elem *tls.Certificate } -*func([][]uint8, [][]*x509.Certificate) error -*func(string) (*tls.ClientSessionState, bool) -*struct { F uintptr; R json.condAddrEncoder } -*[8]struct { key chi.methodTyp; elem string } -*[8]struct { key string; elem chi.methodTyp } -*struct { F uintptr; X0 zapcore.WriteSyncer } -*func(*zapcore.CheckedEntry, []zapcore.Field) -*[8]struct { key zapcore.Level; elem string } -github.com/getsentry/sentry-go/internal/debug -*[8]struct { key *syntax.Regexp; elem int64 } -*struct { key string; elem syntax.charGroup } -*struct { F uintptr; X0 proxy.ContextDialer } -*struct { key uint64; elem *profile.Mapping } -*[]struct { key string; elem *pprof.Profile } -*[]struct { key uintptr; elem pprof.locInfo } .*[]struct { key string; elem []net.nssSource } .*[8]struct { key string; elem map[string]int } .*struct { key uint32; elem *http.http2stream } .*struct { key string; elem *http.routingNode } .*map[http.connectMethodKey][]*http.persistConn .*[8]struct { key http.ConnState; elem string } .*struct { key http.http2ErrCode; elem string } .*[]struct { key http.http2Flags; elem string } .*map[http.http2FrameType]http.http2frameParser .*struct { key http.http2SettingID; elem bool } .*[8]struct { key string; elem []*http.Cookie } .*struct { key string; elem http.RoundTripper } .*struct { F uintptr; X0 *http.transferWriter } .*struct { F uintptr; R *http.http2ClientConn } .*struct { F uintptr; R *http.http2serverConn } .cloudlinux.com/defence360.git/src/proxy/config .*struct { key *reflect.structType; elem bool } .*[]*sync.node[*internal/abi.Type,interface {}] .*[]struct { key *abi.Type; elem interface {} } .*[8]struct { key abi.TypeOff; elem *abi.Type } .*func(*big.Int, *big.Int) (*big.Int, *big.Int) .*struct { key string; elem map[string]string } .*[]struct { key interface {}; elem struct {} } .*[]struct { key uint32; elem *fsnotify.watch } .*func(zapcore.Entry, zapcore.SamplingDecision) Thereafter#json:"thereafter" yaml:"thereafter" .*struct { F uintptr; X0 zapcore.LevelEnabler } .*[]struct { key logrus.fieldKey; elem string } MessageKey#json:"messageKey" yaml:"messageKey" LineEnding#json:"lineEnding" yaml:"lineEnding" .*map.group[platform.OSArch]platform.osArchInfo .*struct { key string; elem language.Language } .*map.group[profile.mappingKey]*profile.Mapping .*struct { key uint64; elem *profile.Function } .*struct { key uint64; elem *profile.Location } .*[]struct { key uint64; elem profile.mapInfo } .*[]struct { key interface {}; elem []uintptr } .*[8]struct { key string; elem *pprof.Profile } .*[8]struct { key uintptr; elem pprof.locInfo } /*struct { F uintptr; X0 *agent.ConnectionPool } /*[8]struct { key string; elem []net.nssSource } /*func(net.byRFC6724Info, net.byRFC6724Info) int /*[]struct { key *net.Listener; elem struct {} } /*map.group[http.routingIndexKey][]*http.pattern /*struct { key http.connectMethodKey; elem int } /*[]struct { key [8]uint8; elem chan struct {} } /*[8]struct { key http.http2Flags; elem string } /*struct { F uintptr; X0 *http.http2ClientConn } /*struct { F uintptr; X0 *http.http2serverConn } /*map.group[uint64]*sentry.profileThreadMetadata /*interface { Bytes() []uint8; Overflow() bool } /*struct { key interface {}; elem interface {} } /*go.shape.struct { internal/sync.isEntry bool } /*struct { F uintptr; X0 *sentry.ClientOptions } /*struct { F uintptr; X0 *sentry.HTTPTransport } /*[]struct { key *reflect.structType; elem int } /*sync.indirect[*internal/abi.Type,interface {}] /*[]*sync.entry[*internal/abi.Type,interface {}] /*[0]*sync.node[*internal/abi.Type,interface {}] /*[8]struct { key *abi.Type; elem interface {} } /*struct { key string; elem runtime.metricData } /*[]struct { key dnsmessage.Class; elem string } /*[]struct { key dnsmessage.RCode; elem string } /*struct { key dnsmessage.section; elem string } /*struct { key string; elem *singleflight.call } /*[]struct { key string; elem *tls.Certificate } /*[8]struct { key interface {}; elem struct {} } /*[8]struct { key uint32; elem *fsnotify.watch } /*zap.anyFieldC[[]go.uber.org/zap/zapcore.Field] /*struct { F uintptr; R *mqtt.connectionStatus } /*[8]struct { key logrus.fieldKey; elem string } /*struct { key zapcore.Level; elem color.Color } /*func([]uint8, []uint8, bool) (int, int, error) /*[]struct { key string; elem syntax.charGroup } /*struct { F uintptr; R websocket.proxy_Dialer } /*func() (map[string]int32, map[string][2]int32) /*[]struct { key uint64; elem *profile.Mapping } /*[8]struct { key uint64; elem profile.mapInfo } /*[8]struct { key interface {}; elem []uintptr } 0*struct { key context.canceler; elem struct {} } 0*struct { key net.hostLookupOrder; elem string } 0*func(context.Context, net.Conn) context.Context 0*[8]struct { key *net.Listener; elem struct {} } 0*[]struct { key uint32; elem *http.http2stream } 0*[]struct { key string; elem *http.routingNode } 0*map.group[*http.Request]context.CancelCauseFunc 0*[8]struct { key [8]uint8; elem chan struct {} } 0*struct { key string; elem *http.http2dialCall } 0*interface { SetWriteDeadline(time.Time) error } 0*[]struct { key http.http2ErrCode; elem string } 0*struct { key http.http2FrameType; elem string } 0*[]struct { key http.http2SettingID; elem bool } 0*struct { key http.http2SettingID; elem string } 0*[]struct { key string; elem http.RoundTripper } 0*struct { F uintptr; R *http.http2clientStream } 0*struct { key logrus.Level; elem []logrus.Hook } 0*func([]sentry.Integration) []sentry.Integration 0*map.group[ratelimit.Category]ratelimit.Deadline 0*[]struct { key *reflect.structType; elem bool } 0*[8]struct { key *reflect.structType; elem int } 0*[0]*sync.entry[*internal/abi.Type,interface {}] 0*[8]struct { key dnsmessage.Class; elem string } 0*[8]struct { key dnsmessage.RCode; elem string } 0*[8]struct { key string; elem *tls.Certificate } 0*func(*tls.ClientHelloInfo) (*tls.Config, error) 0*[]struct { key string; elem map[string]string } 0*struct { F uintptr; X0 *httptrace.ClientTrace } 0*struct { key hpack.pairNameValue; elem uint64 } 0*struct { key string; elem *unicode.RangeTable } 0*struct { key uint16; elem mqtt.tokenCompletor } 0*struct { key string; elem *mqtt.backoffStatus } EncodeTime%json:"timeEncoder" yaml:"timeEncoder" EncodeName%json:"nameEncoder" yaml:"nameEncoder" 0*pool.Pool[*go.uber.org/zap/zapcore.jsonEncoder] 0*struct { key *x509.policyGraphNode; elem bool } 0*[8]struct { key string; elem syntax.charGroup } 0*struct { F uintptr; R *socks.UsernamePassword } 0*struct { F uintptr; X0 *os.File; X1 *exec.Cmd } 0*struct { F uintptr; X0 io.Writer; X1 *os.File } 0*[]struct { key string; elem language.Language } 0*map.group[profile.functionKey]*profile.Function 0*map.group[profile.locationKey]*profile.Location 0*[]struct { key uint64; elem *profile.Function } 0*[]struct { key uint64; elem *profile.Location } 0*[8]struct { key uint64; elem *profile.Mapping } 1*struct { F uintptr; X0 func(int) error; X1 int } 1*[8]struct { key uint32; elem *http.http2stream } 1*[8]struct { key string; elem *http.routingNode } 1*[]struct { key http.connectMethodKey; elem int } 1*[8]struct { key http.http2ErrCode; elem string } 1*[8]struct { key http.http2SettingID; elem bool } 1*[8]struct { key string; elem http.RoundTripper } 1*func(*http.Server, net.Conn, http.Handler, bool) 1*func(string, string, net.Conn) http.RoundTripper 1*func(string, int, fs.FileMode) (*os.File, error) 1*func() (unsafe.Pointer, syscall._Socklen, error) InstructionAddr!json:"instruction_addr,omitempty" ElapsedSinceStartNS json:"elapsed_since_start_ns" TransactionInfo!json:"transaction_info,omitempty" 1*[]struct { key interface {}; elem interface {} } 1*[8]struct { key *reflect.structType; elem bool } 1*struct { key runtime._typePair; elem struct {} } 1*[]struct { key string; elem runtime.metricData } 1*struct { F uintptr; X0 func(func()); X1 func() } 1*[]struct { key dnsmessage.section; elem string } 1*[]struct { key string; elem *singleflight.call } 1*func([]uint8, []uint8, []uint8, []uint8) []uint8 1*struct { key uint16; elem func() *hpke.hkdfKDF } 1*[8]struct { key string; elem map[string]string } 1*struct { key chi.methodTyp; elem *chi.endpoint } 1*struct { F uintptr; X0 middleware.LogFormatter } 1*struct { Level *zapcore.Level "json:\"level\"" } Development%json:"development" yaml:"development" OutputPaths%json:"outputPaths" yaml:"outputPaths" FunctionKey%json:"functionKey" yaml:"functionKey" 1*pool.Pool[*go.uber.org/zap/zapcore.CheckedEntry] 1*pool.Pool[*go.uber.org/zap/zapcore.errArrayElem] 1*[]struct { key zapcore.Level; elem color.Color } 1github.com/getsentry/sentry-go/internal/ratelimit 1*func(pprof.profileEntry, pprof.profileEntry) int 1*[8]struct { key string; elem language.Language } 1*[8]struct { key uint64; elem *profile.Function } 1*[8]struct { key uint64; elem *profile.Location } 1*struct { key uintptr; elem *pprof.profMapEntry } 2*[]struct { key context.canceler; elem struct {} } 2*[]struct { key net.hostLookupOrder; elem string } 2*struct { key uint32; elem *http.http2writeQueue } 2*[8]struct { key http.connectMethodKey; elem int } 2*[]struct { key string; elem *http.http2dialCall } 2*[]struct { key http.http2FrameType; elem string } 2*[]struct { key http.http2SettingID; elem string } 2*[]struct { key logrus.Level; elem []logrus.Hook } 2*[8]struct { key interface {}; elem interface {} } 2*[]*go.shape.struct { internal/sync.isEntry bool } 2*sync.HashTrieMap[*internal/abi.Type,interface {}] 2*[]*sync.indirect[*internal/abi.Type,interface {}] 2*[8]struct { key string; elem runtime.metricData } 2*[8]struct { key dnsmessage.section; elem string } 2*[8]struct { key string; elem *singleflight.call } 2*[]struct { key hpack.pairNameValue; elem uint64 } 2*[]struct { key string; elem *unicode.RangeTable } 2*map.group[string]func(*url.URL) (zap.Sink, error) 2*struct { key string; elem packets.ControlPacket } 2*[]struct { key uint16; elem mqtt.tokenCompletor } 2*[]struct { key string; elem *mqtt.backoffStatus } 2*[8]struct { key zapcore.Level; elem color.Color } 2*[]struct { key *x509.policyGraphNode; elem bool } 2*struct { key string; elem *x509.policyGraphNode } 2*struct { key ratelimit.Category; elem struct {} } 3*[8]struct { key context.canceler; elem struct {} } 3*[8]struct { key net.hostLookupOrder; elem string } 3*map.group[http.connectMethodKey]http.wantConnQueue 3*[8]struct { key string; elem *http.http2dialCall } 3*struct { key string; elem *http.http2addConnCall } 3*map[http.http2FrameType]map[http.http2Flags]string 3*[8]struct { key http.http2FrameType; elem string } 3*[8]struct { key http.http2SettingID; elem string } 3*struct { F uintptr; X0 chan struct {}; X1 func() } 3*[8]struct { key logrus.Level; elem []logrus.Hook } 3*[0]*go.shape.struct { internal/sync.isEntry bool } 3*struct { F uintptr; R *sentry.modulesIntegration } 3*[0]*sync.indirect[*internal/abi.Type,interface {}] 3*func(*runtime.statAggregate, *runtime.metricValue) 3*[]struct { key runtime._typePair; elem struct {} } 3*[]struct { key uint16; elem func() *hpke.hkdfKDF } 3*[8]struct { key hpack.pairNameValue; elem uint64 } 3*[8]struct { key string; elem *unicode.RangeTable } 3*[]struct { key chi.methodTyp; elem *chi.endpoint } 3*func(string, uint8, bool, interface {}) mqtt.Token 3*[8]struct { key uint16; elem mqtt.tokenCompletor } 3*[8]struct { key string; elem *mqtt.backoffStatus } EncodeLevel'json:"levelEncoder" yaml:"levelEncoder" 3*[8]struct { key *x509.policyGraphNode; elem bool } 3*func(*url.URL, proxy.Dialer) (proxy.Dialer, error) 3*struct { F uintptr; X0 *buildcfg.ExperimentFlags } 3*[]struct { key uintptr; elem *pprof.profMapEntry } 4*[]struct { key uint32; elem *http.http2writeQueue } 4*func(string, string, *tls.Config) (net.Conn, error) 4*map.group[http.connectMethodKey][]*http.persistConn 4*struct { key uint32; elem *http.http2clientStream } 4*struct { key string; elem []*http.http2ClientConn } 4*struct { key *http.http2ClientConn; elem []string } 4*map.group[http.http2FrameType]http.http2frameParser 4*struct { key string; elem []*multipart.FileHeader } 4*struct { F uintptr; R *http.socksUsernamePassword } 4*struct { F uintptr; X0 *mqtt.Publisher; X1 string } 4*struct { key string; elem map[string]interface {} } IsExceptionGroup#json:"is_exception_group,omitempty" 4*func(func(string) bool) (reflect.StructField, bool) 4*[8]struct { key runtime._typePair; elem struct {} } 4*[8]struct { key uint16; elem func() *hpke.hkdfKDF } 4*[8]struct { key chi.methodTyp; elem *chi.endpoint } 4*func(...func(http.Handler) http.Handler) chi.Router 4*[]struct { key string; elem packets.ControlPacket } 4*func(string, uint8, mqtt.MessageHandler) mqtt.Token 4*struct { F uintptr; X0 *mqtt.client; X1 io.Writer } 4*[]struct { key string; elem *x509.policyGraphNode } 4*struct { key string; elem []*x509.policyGraphNode } 4github.com/getsentry/sentry-go/internal/otel/baggage 4*[]struct { key ratelimit.Category; elem struct {} } 4*[8]struct { key uintptr; elem *pprof.profMapEntry } 4*edwards25519.fiatScalarMontgomeryDomainFieldElement 5*struct { F uintptr; X0 *context.timerCtx; X1 error } 5*func(<-chan singleflight.Result, context.CancelFunc) 5*struct { key *http.http2serverConn; elem struct {} } 5*[8]struct { key uint32; elem *http.http2writeQueue } 5*struct { key *http.persistConn; elem *list.Element } 5*map[string]func(string, *tls.Conn) http.RoundTripper 5*[]struct { key string; elem *http.http2addConnCall } 5*func(*sentry.Event, *sentry.EventHint) *sentry.Event VersionPatchlevel#json:"version_patchlevel,omitempty" RecoveryThreshold#json:"recovery_threshold,omitempty" 5*struct { Size uint32; Mallocs uint64; Frees uint64 } 5*struct { F uintptr; X0 *runtime.traceAdvancerState } 5*func(*tls.ClientHelloInfo) (*tls.Certificate, error) 5*struct { F uintptr; X0 *tls13.ExporterMasterSecret } 5*struct { key string; elem func() jwt.SigningMethod } 5*func(zapcore.EncoderConfig) (zapcore.Encoder, error) 5*[8]struct { key string; elem packets.ControlPacket } TrailerField(asn1:"optional,explicit,tag:3,default:1" 5*[8]struct { key string; elem *x509.policyGraphNode } 5*[8]struct { key ratelimit.Category; elem struct {} } (txc SZ6p !J|o /OJB =_YM ;_Q= .s^H k%5p +PB& +kI7 cN < 4x7E K3Ns 6*[]struct { key uint32; elem *http.http2clientStream } 6*[]struct { key string; elem []*http.http2ClientConn } 6*[]struct { key *http.http2ClientConn; elem []string } 6*[8]struct { key string; elem *http.http2addConnCall } 6*[]struct { key string; elem []*multipart.FileHeader } 6*struct { F uintptr; X0 chan bool; X1 chan struct {} } 6*struct { key chan<- os.Signal; elem *signal.handler } 6*[]struct { key string; elem map[string]interface {} } 6*struct { F uintptr; R *sentry.globalTagsIntegration } B2 } P%W} agD= U>y 6*interface { Any(string, interface {}) zapcore.Field } 6*zap.anyFieldC[go.uber.org/zap/zapcore.ArrayMarshaler] 6*pool.Pool[*go.uber.org/zap/internal/stacktrace.Stack] EncodeCaller)json:"callerEncoder" yaml:"callerEncoder" 6*pool.Pool[*go.uber.org/zap/zapcore.sliceArrayEncoder] 6*[]struct { key string; elem []*x509.policyGraphNode } W!m* 6*ecdh.Curve[*crypto/internal/fips140/nistec.P256Point] 6*ecdh.Curve[*crypto/internal/fips140/nistec.P384Point] 6*ecdh.Curve[*crypto/internal/fips140/nistec.P521Point] $c* g:nr 7*[]struct { key *http.http2serverConn; elem struct {} } 7*map[string]func(*http.Server, *tls.Conn, http.Handler) 7*[]struct { key *http.persistConn; elem *list.Element } 7*[8]struct { key uint32; elem *http.http2clientStream } 7*[8]struct { key string; elem []*http.http2ClientConn } 7*[8]struct { key *http.http2ClientConn; elem []string } 7*[8]struct { key string; elem []*multipart.FileHeader } 7*struct { F uintptr; R *http.http2serverInternalState } 7*struct { F uintptr; X0 func(io.Reader); X1 io.Reader } 7*interface { Network() poll.String; PollFD() *poll.FD } 7*[8]struct { key string; elem map[string]interface {} } 7*sync.node[go.shape.interface {},go.shape.interface {}] 7*struct { F uintptr; R *sentry.environmentIntegration } 7*[]struct { Size uint32; Mallocs uint64; Frees uint64 } 7*func(*big.Int, *big.Int, []uint8) (*big.Int, *big.Int) 7*[]struct { key string; elem func() jwt.SigningMethod } 7*zap.anyFieldC[go.uber.org/zap/zapcore.ObjectMarshaler] DisableCaller)json:"disableCaller" yaml:"disableCaller" EncoderConfig)json:"encoderConfig" yaml:"encoderConfig" InitialFields)json:"initialFields" yaml:"initialFields" 7*func(map[string]uint8, mqtt.MessageHandler) mqtt.Token StacktraceKey)json:"stacktraceKey" yaml:"stacktraceKey" 7*[8]struct { key string; elem []*x509.policyGraphNode } 7*ecdsa.Curve[*crypto/internal/fips140/nistec.P224Point] 7*ecdsa.Curve[*crypto/internal/fips140/nistec.P256Point] 7*ecdsa.Curve[*crypto/internal/fips140/nistec.P384Point] 7*ecdsa.Curve[*crypto/internal/fips140/nistec.P521Point] 7*struct { key profile.sampleKey; elem *profile.Sample } 8*func(context.Context, string, string) (net.Conn, error) 8*[8]struct { key *http.http2serverConn; elem struct {} } 8*[8]struct { key *http.persistConn; elem *list.Element } 8*struct { F uintptr; X0 *http.conn; X1 context.Context } 8*[]struct { key chan<- os.Signal; elem *signal.handler } 8*struct { key sentry.TransactionSource; elem struct {} } 8*sync.entry[go.shape.interface {},go.shape.interface {}] 8*struct { F uintptr; R *sentry.ignoreErrorsIntegration } 8*map[netip.addrDetail]weak.Pointer[net/netip.addrDetail] 8*[8]struct { key string; elem func() jwt.SigningMethod } 8*struct { F uintptr; X0 *sync.WaitGroup; X1 chan error } 9*map.group[http.http2FrameType]map[http.http2Flags]string 9*struct { F uintptr; X0 *http.http2stream; X1 time.Time } 9*[8]struct { key chan<- os.Signal; elem *signal.handler } 9*[61]struct { Size uint32; Mallocs uint64; Frees uint64 } 9*struct { F uintptr; X0 reflect.Value; X1 reflect.Value } 9*func(json.reflectWithString, json.reflectWithString) int 9*func(int, int, http.Header, time.Duration, interface {}) 9*struct { F uintptr; X0 func(zapcore.Core) zapcore.Core } 9*struct { F uintptr; X0 *mqtt.client; X1 chan struct {} } 9*struct { F uintptr; X0 *mqtt.connectionStatus; X1 bool } 9*struct { key platform.OSArch; elem platform.osArchInfo } 9*func(*ecdh.PrivateKey, *ecdh.PublicKey) ([]uint8, error) 9*struct { F uintptr; X0 *net.Dialer; X1 context.Context } 9*struct { key profile.mappingKey; elem *profile.Mapping } 9*[]struct { key profile.sampleKey; elem *profile.Sample } :*struct { key http.routingIndexKey; elem []*http.pattern } MessageReporterIncrement!json:"message_reporter_increment" :*struct { key uint64; elem *sentry.profileThreadMetadata } :*[]struct { key sentry.TransactionSource; elem struct {} } :*func([]uint8, []uint8, []uint8, []uint8) ([]uint8, error) SkipLineEnding+json:"skipLineEnding" yaml:"skipLineEnding" :*struct { F uintptr; X0 *bytes.Buffer; X1 **http.Request } :*[8]struct { key profile.sampleKey; elem *profile.Sample } ;*func(*http.Request, string) (*http.http2ClientConn, error) ;*struct { key *http.Request; elem context.CancelCauseFunc } ;*map.group[string]func(string, *tls.Conn) http.RoundTripper ;*[8]struct { key sentry.TransactionSource; elem struct {} } ;*[]*sync.entry[go.shape.interface {},go.shape.interface {}] ;*sync.indirect[go.shape.interface {},go.shape.interface {}] ;*struct { key ratelimit.Category; elem ratelimit.Deadline } ;*go.shape.struct { Key reflect.Value; Value reflect.Value } ;*struct { Layout string "json:\"layout\" yaml:\"layout\"" } ;*[]struct { key platform.OSArch; elem platform.osArchInfo } ;*struct { key profile.functionKey; elem *profile.Function } ;*struct { key profile.locationKey; elem *profile.Location } ;*[]struct { key profile.mappingKey; elem *profile.Mapping } <*func(context.Context, string, string) ([]net.IPAddr, error) <*[]struct { key http.routingIndexKey; elem []*http.pattern } <*struct { F uintptr; X0 *http.Transport; X1 *http.wantConn } <*[]struct { key uint64; elem *sentry.profileThreadMetadata } <*[0]*sync.entry[go.shape.interface {},go.shape.interface {}] <*struct { F uintptr; R *sentry.contextifyFramesIntegration } <*func(*tls.CertificateRequestInfo) (*tls.Certificate, error) <*struct { F uintptr; X0 *tls.cacheEntry; X1 *tls.certCache } <*struct { F uintptr; X0 *sync.WaitGroup; X1 chan struct {} } EncodeDuration-json:"durationEncoder" yaml:"durationEncoder" <*[8]struct { key platform.OSArch; elem platform.osArchInfo } <*[8]struct { key profile.mappingKey; elem *profile.Mapping } =*func(context.Context, string, string, syscall.RawConn) error =*map.group[string]func(*http.Server, *tls.Conn, http.Handler) =*[8]struct { key http.routingIndexKey; elem []*http.pattern } =*[]struct { key *http.Request; elem context.CancelCauseFunc } =*func(context.Context, *url.URL, string) (http.Header, error) =*struct { F uintptr; X0 *interface {}; X1 *bool; X2 *func() } =*[8]struct { key uint64; elem *sentry.profileThreadMetadata } =*[]struct { key ratelimit.Category; elem ratelimit.Deadline } =*sync.node[go.shape.*internal/abi.Type,go.shape.interface {}] =*struct { key string; elem func(*url.URL) (zap.Sink, error) } =*struct { F uintptr; X0 *zap.SamplingConfig; X1 *zap.Config } =*func(zapcore.Entry, []zapcore.Field) (*buffer.Buffer, error) =*func(io.Reader, []uint8, crypto.SignerOpts) ([]uint8, error) =*struct { F uintptr; X0 *exec.Cmd; X1 chan<- exec.ctxResult } =*struct { F uintptr; X0 func(func() error); X1 func() error } =*[]struct { key profile.functionKey; elem *profile.Function } =*[]struct { key profile.locationKey; elem *profile.Location } =*func(context.Context, io.ReadWriter, socks.AuthMethod) error ` Z* &W>r Wbbi >*struct { F uintptr; X0 context.Context; X1 context.canceler } >*struct { F uintptr; X0 context.canceler; X1 context.Context } Jf_Q >*struct { key http.connectMethodKey; elem http.wantConnQueue } >*[8]struct { key *http.Request; elem context.CancelCauseFunc } >*struct { F uintptr; X0 *http.http2serverConn; X1 chan error } >*struct { F uintptr; X0 *auth.Authenticator; X1 http.Handler } FailureIssueThreshold(json:"failure_issue_threshold,omitempty" >*atomic.Pointer[internal/sync.node[interface {},interface {}]] >*[8]struct { key ratelimit.Category; elem ratelimit.Deadline } >*struct { F uintptr; R *sentry.ignoreTransactionsIntegration } >*func() (netip.addrDetail, weak.Pointer[net/netip.addrDetail]) >*map.group[netip.addrDetail]weak.Pointer[net/netip.addrDetail] >*sync.entry[go.shape.*internal/abi.Type,go.shape.interface {}] >*func([]uint8, tls.ConnectionState) (*tls.SessionState, error) >*func(tls.ConnectionState, *tls.SessionState) ([]uint8, error) >*elliptic.nistCurve[*crypto/internal/fips140/nistec.P384Point] >*elliptic.nistCurve[*crypto/internal/fips140/nistec.P521Point] >*elliptic.nistCurve[*crypto/internal/fips140/nistec.P256Point] >*struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 } >*elliptic.nistCurve[*crypto/internal/fips140/nistec.P224Point] >*map[string]func(*url.URL, proxy.Dialer) (proxy.Dialer, error) cFV% >*[8]struct { key profile.functionKey; elem *profile.Function } >*[8]struct { key profile.locationKey; elem *profile.Location } ?*struct { key http.connectMethodKey; elem []*http.persistConn } ?*struct { key http.http2FrameType; elem http.http2frameParser } ?*atomic.Pointer[internal/sync.entry[interface {},interface {}]] ?*atomic.Pointer[go.shape.struct { internal/sync.isEntry bool }] ?*struct { F uintptr; X0 *sync.WaitGroup; X1 *json.encoderFunc } ?*[]struct { key string; elem func(*url.URL) (zap.Sink, error) } ?*struct { F uintptr; X0 *mqtt.client; X1 mqtt.connCompletedFn } ?*struct { F uintptr; X0 mqtt.OnConnectHandler; X1 mqtt.Client } ?*struct { F uintptr; X0 *websocket.Dialer; X1 context.Context } ?*func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P224Point] ?*func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P256Point] ?*func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P384Point] ?*func() *ecdsa.Curve[*crypto/internal/fips140/nistec.P521Point] ?*go.shape.struct { Count int64; Cycles int64; Stack []uintptr } @*[]struct { key http.connectMethodKey; elem http.wantConnQueue } @*[]atomic.Pointer[internal/sync.node[interface {},interface {}]] @*func(netip.addrDetail, weak.Pointer[net/netip.addrDetail]) bool @*[8]struct { key string; elem func(*url.URL) (zap.Sink, error) } @*map[string]func(zapcore.EncoderConfig) (zapcore.Encoder, error) ErrorOutputPaths/json:"errorOutputPaths" yaml:"errorOutputPaths" @*struct { F uintptr; X0 func() go.shape.*uint8; X1 *[4]uintptr } ConsoleSeparator/json:"consoleSeparator" yaml:"consoleSeparator" @*struct { F uintptr; X0 func() go.shape.*uint8; X1 *[3]uintptr } A*go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string } A*[]struct { key http.connectMethodKey; elem []*http.persistConn } A*[8]struct { key http.connectMethodKey; elem http.wantConnQueue } A*[]struct { key http.http2FrameType; elem http.http2frameParser } A*[]atomic.Pointer[go.shape.struct { internal/sync.isEntry bool }] A*[]*sync.entry[go.shape.*internal/abi.Type,go.shape.interface {}] A*sync.indirect[go.shape.*internal/abi.Type,go.shape.interface {}] A*func(zapcore.Entry, *zapcore.CheckedEntry) *zapcore.CheckedEntry A*func() (go.shape.map[string]int32, go.shape.map[string][2]int32) B*[8]struct { key http.connectMethodKey; elem []*http.persistConn } B*[8]struct { key http.http2FrameType; elem http.http2frameParser } B*go.shape.struct { net/http.key string; net/http.values []string } B*struct { F uintptr; X0 *int64; X1 *error; X2 *bool; X3 *poll.FD } B*atomic.Pointer[internal/sync.indirect[interface {},interface {}]] B*[16]atomic.Pointer[internal/sync.node[interface {},interface {}]] B*[0]*sync.entry[go.shape.*internal/abi.Type,go.shape.interface {}] B*func(*big.Int, *big.Int, *big.Int, *big.Int) (*big.Int, *big.Int) B*struct { F uintptr; X0 middleware.LogFormatter; X1 http.Handler } B*struct { F uintptr; X0 chan struct {}; X1 *mqtt.client; X2 uint } B*struct { F uintptr; X0 chan exec.goroutineStatus; X1 chan error } C*struct { F uintptr; X0 func(dnsmessage.Type); X1 dnsmessage.Type } C*[16]atomic.Pointer[go.shape.struct { internal/sync.isEntry bool }] C*sync.node[net/netip.addrDetail,weak.Pointer[net/netip.addrDetail]] DisableStacktrace1json:"disableStacktrace" yaml:"disableStacktrace" D*struct { key http.http2FrameType; elem map[http.http2Flags]string } D*struct { F uintptr; X0 *http.http2clientStream; X1 chan struct {} } D*func(*sentry.Breadcrumb, *sentry.BreadcrumbHint) *sentry.Breadcrumb D*atomic.Pointer[internal/sync.node[*internal/abi.Type,interface {}]] D*sync.entry[net/netip.addrDetail,weak.Pointer[net/netip.addrDetail]] D*[]*go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string } D*map.group[string]func(*url.URL, proxy.Dialer) (proxy.Dialer, error) E*func(context.Context, string, string, *tls.Config) (net.Conn, error) E*func(context.Context, *url.URL, *http.Request, *http.Response) error E*struct { Type string "json:\"type\""; Length int "json:\"length\"" } E*atomic.Pointer[internal/sync.entry[*internal/abi.Type,interface {}]] E*[0]*go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string } E*go.shape.struct { Name string; Href string; Desc string; Count int } Egithub.com/getsentry/sentry-go/internal/otel/baggage/internal/baggage L@5D F*struct { F uintptr; X0 chan error; X1 *http.Server; X2 net.Listener } RinX r'_' :D\, F*struct { key string; elem func(string, *tls.Conn) http.RoundTripper } F*[]struct { key http.http2FrameType; elem map[http.http2Flags]string } tcw= nehn Hq+r F*[]atomic.Pointer[internal/sync.node[*internal/abi.Type,interface {}]] F*[]*sync.node[net/netip.addrDetail,weak.Pointer[net/netip.addrDetail]] F*func(func(netip.addrDetail, weak.Pointer[net/netip.addrDetail]) bool) xHN9 sB?3 F*map.group[string]func(zapcore.EncoderConfig) (zapcore.Encoder, error) k/GL p-H3 $~!* j}tM G*[8]struct { key http.http2FrameType; elem map[http.http2Flags]string } G*sync.indirect[net/netip.addrDetail,weak.Pointer[net/netip.addrDetail]] G*[]*sync.entry[net/netip.addrDetail,weak.Pointer[net/netip.addrDetail]] G*[0]*sync.node[net/netip.addrDetail,weak.Pointer[net/netip.addrDetail]] G*struct { F uintptr; X0 func(zapcore.Entry, zapcore.SamplingDecision) } G*func(*url.URL, websocket.proxy_Dialer) (websocket.proxy_Dialer, error) H*struct { key string; elem func(*http.Server, *tls.Conn, http.Handler) } H*[]struct { key string; elem func(string, *tls.Conn) http.RoundTripper } H*atomic.Pointer[internal/sync.indirect[*internal/abi.Type,interface {}]] H*[16]atomic.Pointer[internal/sync.node[*internal/abi.Type,interface {}]] H*[0]*sync.entry[net/netip.addrDetail,weak.Pointer[net/netip.addrDetail]] I*struct { F uintptr; X0 func(context.Context, bool); X1 context.Context } I*[8]struct { key string; elem func(string, *tls.Conn) http.RoundTripper } I*struct { key netip.addrDetail; elem weak.Pointer[net/netip.addrDetail] } I*map[uint16]struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 } I*struct { F uintptr; X0 <-chan error; X1 chan error; X2 *sync.WaitGroup } I*func(profilerecord.MemProfileRecord, profilerecord.MemProfileRecord) int J*[]struct { key string; elem func(*http.Server, *tls.Conn, http.Handler) } J*struct { F uintptr; X0 func(*http.Server, net.Conn, http.Handler, bool) } J*struct { F uintptr; X0 func(string, string, net.Conn) http.RoundTripper } J*sync.HashTrieMap[net/netip.addrDetail,weak.Pointer[net/netip.addrDetail]] J*[]*sync.indirect[net/netip.addrDetail,weak.Pointer[net/netip.addrDetail]] J*go.shape.9fb02d530f4280db41a919d36817386415ddda881b9e412bca2e00b0720525a8 K*struct { F uintptr; X0 *net._Ctype_struct_addrinfo; X1 string; X2 string } K*interface { C() <-chan time.Time; Reset(time.Duration) bool; Stop() bool } K*func(context.Context, time.Duration) (context.Context, context.CancelFunc) K*[8]struct { key string; elem func(*http.Server, *tls.Conn, http.Handler) } K*struct { F uintptr; X0 *sync.Once; X1 func(); X2 *bool; X3 *interface {} } K*[0]*sync.indirect[net/netip.addrDetail,weak.Pointer[net/netip.addrDetail]] K*[]struct { key netip.addrDetail; elem weak.Pointer[net/netip.addrDetail] } K*go.shape.struct { encoding/json.v reflect.Value; encoding/json.ks string } L*struct { F uintptr; X0 *http.http2clientConnPool; X1 *http.http2Transport } L*struct { F uintptr; X0 *http.http2dialCall; X1 context.Context; X2 string } L*struct { F uintptr; X0 chan bool; X1 chan struct {}; X2 *http.persistConn } L*[8]struct { key netip.addrDetail; elem weak.Pointer[net/netip.addrDetail] } M*[]*go.shape.9fb02d530f4280db41a919d36817386415ddda881b9e412bca2e00b0720525a8 M*func(profilerecord.BlockProfileRecord, profilerecord.BlockProfileRecord) int tEAp ,YZ? N*struct { F uintptr; X0 *int64; X1 *error; X2 *bool; X3 *net.netFD; X4 int64 } N*struct { F uintptr; X0 *int; X1 *go.shape.[]go.shape.string; X2 *[4]uintptr } N*struct { F uintptr; X0 *mqtt.Publisher; X1 mqtt.Token; X2 string; X3 string } N*[0]*go.shape.9fb02d530f4280db41a919d36817386415ddda881b9e412bca2e00b0720525a8 N*struct { F uintptr; X0 mqtt.ConnectionLostHandler; X1 mqtt.Client; X2 error } Rc[' N*struct { F uintptr; X0 func(string, string) (net.Conn, error); X1 time.Time } @L%K O*struct { F uintptr; X0 *http.http2serverConn; X1 *http.http2startPushRequest } O*struct { F uintptr; X0 *http.http2serverConn; X1 http.http2FrameWriteRequest } O*map.group[uint16]struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 } O*struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) } O*struct { key string; elem func(*url.URL, proxy.Dialer) (proxy.Dialer, error) } P*func(context.Context, string, *net.TCPAddr, *net.TCPAddr) (*net.TCPConn, error) P*struct { F uintptr; X0 chan struct {}; X1 http.RoundTripper; X2 *http.Request } Q*struct { *sentry.span; ParentSpanID string "json:\"parent_span_id,omitempty\"" } Q*atomic.Pointer[internal/sync.entry[go.shape.interface {},go.shape.interface {}]] Q*struct { key string; elem func(zapcore.EncoderConfig) (zapcore.Encoder, error) } Q*struct { F uintptr; X0 *mqtt.client; X1 context.CancelFunc; X2 context.Context } Q*struct { F uintptr; X0 *struct { sync.Once; v *x509.Certificate }; X1 *[]uint8 } Q*[]struct { key string; elem func(*url.URL, proxy.Dialer) (proxy.Dialer, error) } R*[8]struct { key string; elem func(*url.URL, proxy.Dialer) (proxy.Dialer, error) } R*map[string]func(*url.URL, websocket.proxy_Dialer) (websocket.proxy_Dialer, error) S*unique.uniqueMap[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }] S*[]struct { key string; elem func(zapcore.EncoderConfig) (zapcore.Encoder, error) } T*struct { F uintptr; X0 *http.Client; X1 map[string][]*http.Cookie; X2 http.Header } T*[8]struct { key string; elem func(zapcore.EncoderConfig) (zapcore.Encoder, error) } U*struct { F uintptr; X0 <-chan struct {}; X1 context.CancelFunc; X2 context.Context } CRC `d^< #hU X8p 54c _ag u`:> ySGm `5sO $kP -jx %A|/ SS ac! '2U XVt' lbNS l1T tOLS \x T ]Kc X.[ 9Hp 6JM iSu V*struct { F uintptr; X0 *mqtt.client; X1 *mqtt.ConnectToken; X2 mqtt.connCompletedFn } W*struct { F uintptr; X0 context.CancelCauseFunc; X1 *http.Transport; X2 *http.Request } W*struct { F uintptr; X0 context.Context; X1 context.CancelCauseFunc; X2 *http.Request } W*struct { F uintptr; X0 int; X1 uintptr; X2 func(unsafe.Pointer, unsafe.Pointer) bool } W*atomic.Pointer[internal/sync.entry[go.shape.*internal/abi.Type,go.shape.interface {}]] W*struct { F uintptr; X0 *bytes.Buffer; X1 *io.PipeWriter; X2 *httputil.delegateReader } X*struct { F uintptr; X0 context.Context; X1 net.Conn; X2 chan error; X3 chan struct {} } X*struct { *sentry.breadcrumb; Timestamp json.RawMessage "json:\"timestamp,omitempty\"" } X*func(*tls.Config, *tls.Certificate, *tls.clientKeyExchangeMsg, uint16) ([]uint8, error) X*struct { F uintptr; X0 *mqtt.PublishToken; X1 context.Context; X2 *semaphore.Weighted } X*map.group[string]func(*url.URL, websocket.proxy_Dialer) (websocket.proxy_Dialer, error) X*struct { F uintptr; X0 *io.PipeReader; X1 *httputil.delegateReader; X2 chan struct {} } Y*struct { F uintptr; X0 []uint8; X1 []uint8; X2 uint16; X3 *tls.cipherSuite; X4 []uint8 } Y*struct { F uintptr; X0 context.Context; X1 *tls.Conn; X2 chan error; X3 chan struct {} } Z*func(context.Context, []string, map[string]interface {}) (map[string]interface {}, error) Z*struct { F uintptr; X0 *unsafeheader.Slice; X1 uintptr; X2 *abi.Type; X3 unsafe.Pointer } Z*atomic.Pointer[go.shape.9fb02d530f4280db41a919d36817386415ddda881b9e412bca2e00b0720525a8] Z*struct { key uint16; elem struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 } } Z*map[uint16]struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) } [*struct { F uintptr; X0 *http.http2ClientConn; X1 *error; X2 *[8]uint8; X3 chan struct {} } \*atomic.Pointer[internal/sync.node[net/netip.addrDetail,weak.Pointer[net/netip.addrDetail]]] \*[]struct { key uint16; elem struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 } } \*struct { F uintptr; X0 *mqtt.router; X1 *mqtt.client; X2 mqtt.Message; X3 *sync.WaitGroup } ]*atomic.Pointer[internal/sync.entry[net/netip.addrDetail,weak.Pointer[net/netip.addrDetail]]] ]*[8]struct { key uint16; elem struct { curve ecdh.Curve; hash crypto.Hash; nSecret uint16 } } ]*struct { F uintptr; X0 *packets.PublishPacket; X1 chan *mqtt.PacketAndToken; X2 mqtt.Store } UNM- ^*[]atomic.Pointer[internal/sync.node[net/netip.addrDetail,weak.Pointer[net/netip.addrDetail]]] _*func(time.Duration) interface { C() <-chan time.Time; Reset(time.Duration) bool; Stop() bool } _*struct { F uintptr; X0 *packets.ControlPacket; X1 *error; X2 io.Reader; X3 chan mqtt.inbound } `*atomic.Pointer[internal/sync.indirect[net/netip.addrDetail,weak.Pointer[net/netip.addrDetail]]] `*[16]atomic.Pointer[internal/sync.node[net/netip.addrDetail,weak.Pointer[net/netip.addrDetail]]] `*map.group[uint16]struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) } a*struct { F uintptr; X0 *http.http2addConnCall; X1 *http.http2Transport; X2 string; X3 net.Conn } c*struct { F uintptr; X0 mqtt.MessageHandler; X1 *mqtt.client; X2 mqtt.Message; X3 *sync.WaitGroup } c*struct { key string; elem func(*url.URL, websocket.proxy_Dialer) (websocket.proxy_Dialer, error) } d*struct { F uintptr; X0 chan struct {}; X1 mqtt.connectionLostHandledFn; X2 *mqtt.client; X3 error } e*struct { F uintptr; X0 *http.http2clientStream; X1 *http.Request; X2 func(*http.http2clientStream) } e*[]struct { key string; elem func(*url.URL, websocket.proxy_Dialer) (websocket.proxy_Dialer, error) } cj*t k=q 6]F% m5Y! E1W N4s< 8L9 S"3 2@{, vE [DBx r6BG Z1V bZo f*struct { F uintptr; X0 chan struct {}; X1 *error; X2 *http.Request; X3 net.Conn; X4 **http.Response } f*func(*tls.Config, *tls.clientHelloMsg, *x509.Certificate) ([]uint8, *tls.clientKeyExchangeMsg, error) f*[8]struct { key string; elem func(*url.URL, websocket.proxy_Dialer) (websocket.proxy_Dialer, error) } g*func(time.Duration, func()) interface { C() <-chan time.Time; Reset(time.Duration) bool; Stop() bool } h*struct { F uintptr; X0 func() (go.shape.int, error); X1 chan net.result[go.shape.int]; X2 *[4]uintptr } h*struct { F uintptr; X0 *http.http2serverConn; X1 http.http2FrameWriteRequest; X2 *http.http2writeData } i*struct { F uintptr; X0 <-chan struct {}; X1 func(); X2 *time.Timer; X3 *atomic.Bool; X4 chan struct {} } j*struct { F uintptr; X0 *int; X1 map[string]*x509.policyGraphNode; X2 map[string][]*x509.policyGraphNode } k*struct { key uint16; elem struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) } } m*struct { F uintptr; X0 *net.Resolver; X1 context.Context; X2 *net.dnsConfig; X3 string; X4 chan net.result } m*[]struct { key uint16; elem struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) } } iqsD 4YsX n*struct { F uintptr; X0 *interface {}; X1 *bool; X2 *go.shape.bool; X3 *func() go.shape.bool; X4 *[3]uintptr } n*struct { F uintptr; X0 *sync.Once; X1 func(); X2 *bool; X3 *interface {}; X4 *go.shape.bool; X5 *[3]uintptr } n*[8]struct { key uint16; elem struct { keySize int; nonceSize int; aead func([]uint8) (cipher.AEAD, error) } } `pg '(~] n*go.shape.struct { AllocBytes int64; FreeBytes int64; AllocObjects int64; FreeObjects int64; Stack []uintptr } o*struct { F uintptr; X0 <-chan struct {}; X1 *net.netFD; X2 chan error; X3 context.Context; X4 chan struct {} } o*go.shape.interface { BlockSize() int; Reset(); Size() int; Sum([]uint8) []uint8; Write([]uint8) (int, error) } p*struct { F uintptr; X0 *singleflight.Group; X1 *singleflight.call; X2 string; X3 func() (interface {}, error) } p*func(*tls.Config, *tls.clientHelloMsg, *tls.serverHelloMsg, *x509.Certificate, *tls.serverKeyExchangeMsg) error p*struct { F uintptr; X0 *sync.Once; X1 func(); X2 *bool; X3 *interface {}; X4 *go.shape.*uint8; X5 *[3]uintptr } q*go.shape.struct { net.addr net.IPAddr; net.addrAttr net.ipAttr; net.src net/netip.Addr; net.srcAttr net.ipAttr } q*struct { F uintptr; X0 *httptrace.ClientTrace; X1 *tls.Conn; X2 context.Context; X3 *time.Timer; X4 chan error } q*func(*tls.Config, *tls.Certificate, *tls.clientHelloMsg, *tls.serverHelloMsg) (*tls.serverKeyExchangeMsg, error) r*struct { F uintptr; X0 *interface {}; X1 *bool; X2 *go.shape.*uint8; X3 *func() go.shape.*uint8; X4 *[3]uintptr } u*struct { F uintptr; X0 net.addrList; X1 net.addrList; X2 *net.sysDialer; X3 chan net.dialResult; X4 chan struct {} } #?u3 -5E {kX $C@ G+M7 o"t% J36o {};( 6U7g xng v*func() go.shape.interface { BlockSize() int; Reset(); Size() int; Sum([]uint8) []uint8; Write([]uint8) (int, error) } BvS| w*go.shape.struct { weak._ [0]*go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }; weak.u unsafe.Pointer } z*struct { F uintptr; X0 func() (go.shape.[]net.IPAddr, error); X1 chan net.result[go.shape.[]net.IPAddr]; X2 *[4]uintptr } {*struct { F uintptr; X0 *<-chan *packets.PublishPacket; X1 *<-chan error; X2 chan *packets.PublishPacket; X3 *mqtt.client } |*struct { Code string "json:\"code\""; Message string "json:\"message\""; RequestID string "json:\"request_id,omitempty\"" } |*struct { F uintptr; X0 *net.Conn; X1 *error; X2 proxy.Dialer; X3 string; X4 string; X5 chan struct {}; X6 context.Context } }*struct { F uintptr; X0 *unique.uniqueMap[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }]; X1 *[8]uintptr } #>xH JQXy uw9h ~*struct { F uintptr; X0 *<-chan packets.ControlPacket; X1 *<-chan mqtt.inbound; X2 chan mqtt.incomingComms; X3 mqtt.commsFns } 5^w FJ& *struct { F uintptr; X0 context.Context; X1 func(context.Context, string, string) ([]net.IPAddr, error); X2 string; X3 string } *struct { F uintptr; X0 *http.http2Framer; X1 *error; X2 *bool; X3 *hpack.Decoder; X4 *uint32; X5 *http.http2MetaHeadersFrame } *struct { F uintptr; X0 *mqtt.client; X1 chan *mqtt.PacketAndToken; X2 chan *mqtt.PacketAndToken; X3 *<-chan *mqtt.PacketAndToken } *struct { F uintptr; X0 func(<-chan singleflight.Result, context.CancelFunc); X1 <-chan singleflight.Result; X2 context.CancelFunc } N5]1 BBxx y"8 qq$ *struct { F uintptr; X0 *sync.Once; X1 func(); X2 *bool; X3 *interface {}; X4 *go.shape.interface { Error() string }; X5 *[3]uintptr } *struct { F uintptr; X0 chan *mqtt.PacketAndToken; X1 chan *mqtt.PacketAndToken; X2 chan struct {}; X3 chan struct {}; X4 chan struct {} } *struct { F uintptr; X0 *http.http2serverConn; X1 *http.http2responseWriter; X2 *http.Request; X3 func(http.ResponseWriter, *http.Request) } '8|y Cj8v Q"g} D&/@ *struct { F uintptr; X0 <-chan mqtt.incomingComms; X1 chan error; X2 chan *mqtt.PacketAndToken; X3 chan *packets.PublishPacket; X4 *sync.WaitGroup } n < %+=^ +.PT *struct { F uintptr; X0 *sync.HashTrieMap[go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string },go.shape.struct { weak._ [0]*go.shape.struct { net/netip.isV6 bool; net/netip.zoneV6 string }; weak.u unsafe.Pointer }]; X1 *[144]uintptr } W, +r4 V!]u @?ic Z: 80; :% ,..h2%wTe%v%T ">OK|0|12500 TZoklpts=1goosPC[]("")) ) @s Pn=][} +idiv\\\"--%xCcToA4V1V6V2V3V5A3LlLtLuMnCfCoCsLmLoMcMeNdNlNoPcPdPePfPiPoPsScSkSmSoZlZpZsYi{}":%si.o.%-%qgc" 0b0x0X0o \d\D\s\S\w\W\E:]/i13OUCNST=#<<>>&^+=-=*=/=%=&=|=^=&&||<-++==!=<=>=:=ifv1nojs rgGTLTgtltu-zzZZvatcpnilcgodnsudpftpssh::1setnew443ACKGETGet../agevia200404://100...0 ,h1PWD125625nanNaNSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecUTC m=binsysadmwwwntpmanJWTtypalgmsgurl:%s@%s:%d/%sgo:%v gitEOFintmapptr ): finobjgc %: gp *(in n= - P MPC=], < end > ]: ???pc= GTTLsubdupkey///%25Via?*[If-204206304400500 HanLaoMroNkoVai'"'PUT%s => expnbfiataudiss%+vRSADSAURIadxaesshaavxfmanetMD4MD5gcm: ` :80SETvarINT<<=>>=&^=foroffaix386armios ZZZADXDD;GT;Gg;Gt;Im;LT;Ll;Lt;Mu;Nu;Or;Pi;Pr;Re;Sc;Xi;ac;af;ap;dd;ee;eg;el;gE;ge;gg;gl;gt;ic;ii;in;it;lE;le;lg;ll;lt;mp;mu;ne;ni;nu;oS;or;pi;pm;pr;rx;sc;wp;wr;xi;AMPETHREGampdegethnotregshyumlyen%d cpuundmqtttrueicmpigmpftpshttppop3smtp) = dial readfile on bindunixIdleOpenHost<>idle1080DATAPINGPOSTHEADEtag0x%xdateetagfromhostlinkvarypathDateconngzip%x Gonewait/tmpHOMEopenstatsync3125Atoi-Inf+InfquitJuneJuly as hour in /etcuser/sys/dev/run/opt.ssh.aws.envrootmailnscddbussshdhaltnewsuucpinfonameviewtaskarchnull|#%s|T%d: %sboolint8uintchanfunccallkindArgsCall != allgallpitabsbrkdead is LEAFbaseheap of <==GOGC] = s + ,r2= pc=none: p=cas1cas2cas3cas4cas5cas6 at m= sp= sp: lr: fp= gp= mp=) m=bitsNameType --Fromxn--AhomChamKawiLisuMiaoModiNewaThaiTotojson'\''%03d %dB -> : %wMQTT ID %s%dtime%s()warnINFOWARNgo1.ermsfsrmsse3avx2bmi1bmi2,#=:GET cap fail:443asn1typeiotacopyIMAGCHARcaseelsegotoGOOSsse2,lsev8.0wasmmipsPWD=PATHZzzzzzzzAVX2cx16AMP;Acy;Afr;And;Bcy;Bfr;Cap;Cfr;Chi;Cup;Dcy;Del;Dfr;Dot;ENG;ETH;Ecy;Efr;Eta;Fcy;Ffr;Gcy;Gfr;Hat;Hfr;Icy;Ifr;Int;Jcy;Jfr;Kcy;Kfr;Lcy;Lfr;Lsh;Map;Mcy;Mfr;Ncy;Nfr;Not;Ocy;Ofr;Pcy;Pfr;Phi;Psi;Qfr;REG;Rcy;Rfr;Rho;Rsh;Scy;Sfr;Sub;Sum;Sup;Tab;Tau;Tcy;Tfr;Ucy;Ufr;Vcy;Vee;Vfr;Wfr;Xfr;Ycy;Yfr;Zcy;Zfr;acd;acy;afr;amp;and;ang;apE;ape;ast;bcy;bfr;bot;cap;cfr;chi;cir;cup;dcy;deg;dfr;die;div;dot;ecy;efr;egs;ell;els;eng;eta;eth;fcy;ffr;gEl;gap;gcy;gel;geq;ges;gfr;ggg;glE;gla;glj;gnE;gne;hfr;icy;iff;ifr;int;jcy;jfr;kcy;kfr;lEg;lap;lat;lcy;leg;leq;les;lfr;lgE;lnE;lne;loz;lrm;lsh;map;mcy;mfr;mho;mid;nap;ncy;nfr;nge;ngt;nis;niv;nle;nlt;not;npr;nsc;num;ocy;ofr;ogt;ohm;olt;ord;orv;par;pcy;pfr;phi;piv;prE;pre;psi;qfr;rcy;reg;rfr;rho;rlm;rsh;scE;sce;scy;sfr;shy;sim;smt;sol;squ;sub;sum;sup;tau;tcy;tfr;top;ucy;ufr;uml;vcy;vee;vfr;wfr;xfr;ycy;yen;yfr;zcy;zfr;zwj;AumlCOPYEumlIumlOumlQUOTUumlaumlcenteumliumlmacrnbspordfordmoumlparaquotsectsup1sup2sup3uumlyumlacE;bne;nGg;nLl;ngE;nlE;%q%q[FN][FL][LN][IN] %#x.exe190119941996%s%s%s:%dfalseErrorlinuxfileshttpsimap2imap3imapspop3shostswriterouteclose&"':***@bytesRangerange:pathHTTP1HTTP2%s %q%s=%sHTTP/AllowsocksFoundchdirmkdirgetwdpipe2lstat1562578125MarchAprilmonthLocalerror/root/proc/boot.kubemysqlredisnginxhttpdnamedgamessquidcpsespleskDEBUGlevelfatalamd64frame_testtype:trace%s|%sevent%s/%sint16int32int64uint8arrayslice and kind= (at defersweeptestRtestWexecWhchanexecRschedsudogtimergscanmheappanicsleep cnt=gcing MB, got= ... max=scav ptr ] = (trap:init ms, fault tab= top=[...], fp:Classfcntltls: Earlyparseutf-8%s*%dtext/Realmbad nGreekAdlamBamumBatakBuhidDograKhmerLatinLimbuNushuOghamOriyaOsageRunicTakriTamilPATCHTRACE[%s] from mutexblockpath ES256ES384ES512EdDSAHS256HS384HS512RS256RS384RS512PS256PS384PS512valuefounddebugERRORPANICFATALECDSAsse41sse42ssse3SHA-1P-224P-256P-384P-521matchrune float -%sconstIDENTFLOATbreakGO386GOARM%s.%dppc64arm64s390xplan9Aopf;Ascr;Auml;Barv;Beta;Bopf;Bscr;CHcy;COPY;Cdot;Copf;Cscr;DJcy;DScy;DZcy;Darr;Dopf;Dscr;Edot;Eopf;Escr;Esim;Euml;Fopf;Fscr;GJcy;Gdot;Gopf;Gscr;Hopf;Hscr;IEcy;IOcy;Idot;Iopf;Iota;Iscr;Iuml;Jopf;Jscr;KHcy;KJcy;Kopf;Kscr;LJcy;Lang;Larr;Lopf;Lscr;Mopf;Mscr;NJcy;Nopf;Nscr;Oopf;Oscr;Ouml;Popf;Pscr;QUOT;Qopf;Qscr;Rang;Rarr;Ropf;Rscr;SHcy;Sopf;Sqrt;Sscr;Star;TScy;Topf;Tscr;Uarr;Uopf;Upsi;Uscr;Uuml;Vbar;Vert;Vopf;Vscr;Wopf;Wscr;Xopf;Xscr;YAcy;YIcy;YUcy;Yopf;Yscr;Yuml;ZHcy;Zdot;Zeta;Zopf;Zscr;andd;andv;ange;aopf;apid;apos;ascr;auml;bNot;bbrk;beta;beth;bnot;bopf;boxH;boxV;boxh;boxv;bscr;bsim;bsol;bull;bump;cdot;cent;chcy;cirE;circ;cire;comp;cong;copf;copy;cscr;csub;csup;dArr;dHar;darr;dash;diam;djcy;dopf;dscr;dscy;dsol;dtri;dzcy;eDot;ecir;edot;emsp;ensp;eopf;epar;epsi;escr;esim;euml;euro;excl;flat;fnof;fopf;fork;fscr;gdot;geqq;gjcy;gnap;gneq;gopf;gscr;gsim;gtcc;hArr;half;harr;hbar;hopf;hscr;iecy;imof;iocy;iopf;iota;iscr;isin;iuml;jopf;jscr;khcy;kjcy;kopf;kscr;lArr;lHar;lang;larr;late;lcub;ldca;ldsh;leqq;ljcy;lnap;lneq;lopf;lozf;lpar;lscr;lsim;lsqb;ltcc;ltri;macr;male;malt;mlcp;mldr;mopf;mscr;nbsp;ncap;ncup;ngeq;ngtr;nisd;njcy;nldr;nleq;nmid;nopf;npar;nscr;nsim;nsub;nsup;ntgl;ntlg;oast;ocir;odiv;odot;ogon;oint;omid;oopf;opar;ordf;ordm;oror;oscr;osol;ouml;para;part;perp;phiv;plus;popf;prap;prec;prnE;prod;prop;pscr;qint;qopf;qscr;quot;rArr;rHar;rang;rarr;rcub;rdca;rdsh;real;rect;rhov;ring;ropf;rpar;rscr;rsqb;rtri;scap;scnE;sdot;sect;semi;sext;shcy;sime;simg;siml;smid;smte;solb;sopf;spar;squf;sscr;star;subE;sube;succ;sung;sup1;sup2;sup3;supE;supe;tbrk;tdot;tint;toea;topf;tosa;trie;tscr;tscy;uArr;uHar;uarr;uopf;upsi;uscr;utri;uuml;vArr;vBar;varr;vert;vopf;vscr;wopf;wscr;xcap;xcup;xmap;xnis;xopf;xscr;xvee;yacy;yicy;yopf;yscr;yucy;yuml;zdot;zeta;zhcy;zopf;zscr;zwnj;AEligAcircAringEcircIcircOcircTHORNUcircacircacuteaeligaringcedilecircicirciexcllaquomicroocircpoundraquoszligthorntimesucirccaps;cups;gesl;gvnE;lesg;lvnE;nGtv;nLtv;nang;napE;nges;nles;npre;nsce;nvap;nvge;nvgt;nvle;nvlt;race;M=%d %q:%qcountdelayspace.testalukubarlabciavbiskeboontcornugallojauerkkcorkscorlipawnedisnjivanulikosojspeanoputerrigikrozajrumgrsolbasotavuccorFlushWriteStringFormat[]bytestringnetdnsdomaingophertelnetreturn.locallisten.onionndots:ip+netsocketspliceacceptwritevClosedactiveclosedsocks5CANCELGOAWAYPADDEDBasic Cookieallow cookieexpectoriginservermethodschemeExpectstreamstatusPragma. socks LockedreadatTMPDIRremovewaitid390625hangupkilled/proc/errno SundayMondayFridayAugustminutesecondGOROOT%w: %v.gnupg.azure.netrc.npmrcdaemonnobodyapachechronyvsftpdclamavcpanelpsaadmpsaftpdockerX-Authstdoutsystemstderrloggercallercustom0.28.1deviceframesvendorstatsd--long Valueuint16uint32uint64structchan<-<-chansysmontimersefenceselect, not object next= jobs= goid sweep B -> % util alloc free span= prev= list=, i = code= addr=], sp= m->p= p->m=SCHED curg= ctxt: min= max= bad ts(...) m=nil base headerAnswerLengthX25519%w%.0wAcceptServerCommonArabicBrahmiCarianChakmaCopticGothicHangulHatranHebrewKaithiKhojkiLepchaLycianLydianRejangSyriacTai_LeTangsaTangutTeluguThaanaWanchoYezidinumberDELETEallocs "`build %w: %sMQIsdptcp://$shareCausesdpanicDPANIC%s: %s%w: %q%s%s%v%w: %d%s%s%sGOPATHimportrdtscppopcntcmd/goAES-NIsecretsymbolempty rune1 PUBACKPUBRECPUBRELSUBACKSTREETSTRINGswitchGOARCHGOMIPSpower8GOWASM%s.v%dregabidarwinmips64mipslenetbsdwasip1exec: frenchsha256SHA-NIavx512rdrandrdseedsha512AElig;Acirc;Alpha;Amacr;Aogon;Aring;Breve;Ccirc;Colon;Cross;Dashv;Delta;Ecirc;Emacr;Eogon;Equal;Gamma;Gcirc;Hacek;Hcirc;IJlig;Icirc;Imacr;Iogon;Iukcy;Jcirc;Jukcy;Kappa;OElig;Ocirc;Omacr;Omega;Prime;RBarr;Scirc;Sigma;THORN;TRADE;TSHcy;Theta;Tilde;Ubrcy;Ucirc;Umacr;Union;Uogon;UpTee;Uring;VDash;Vdash;Wcirc;Wedge;Ycirc;acirc;acute;aelig;aleph;alpha;amacr;amalg;angle;angrt;angst;aogon;aring;asymp;awint;bcong;bdquo;bepsi;blank;blk12;blk14;blk34;block;boxDL;boxDR;boxDl;boxDr;boxHD;boxHU;boxHd;boxHu;boxUL;boxUR;boxUl;boxUr;boxVH;boxVL;boxVR;boxVh;boxVl;boxVr;boxdL;boxdR;boxdl;boxdr;boxhD;boxhU;boxhd;boxhu;boxuL;boxuR;boxul;boxur;boxvH;boxvL;boxvR;boxvh;boxvl;boxvr;breve;bsemi;bsime;bsolb;bumpE;bumpe;caret;caron;ccaps;ccirc;ccups;cedil;check;clubs;colon;comma;crarr;cross;csube;csupe;ctdot;cuepr;cuesc;cupor;cuvee;cuwed;cwint;dashv;dblac;ddarr;delta;dharl;dharr;diams;disin;doteq;dtdot;dtrif;duarr;duhar;eDDot;ecirc;efDot;emacr;empty;eogon;eplus;epsiv;eqsim;equiv;erDot;erarr;esdot;exist;fflig;filig;fllig;fltns;forkv;frasl;frown;gamma;gcirc;gescc;gimel;gneqq;gnsim;grave;gsime;gsiml;gtcir;gtdot;harrw;hcirc;hoarr;icirc;iexcl;iiint;iiota;ijlig;imacr;image;imath;imped;infin;iogon;iprod;isinE;isins;isinv;iukcy;jcirc;jmath;jukcy;kappa;lAarr;lBarr;langd;laquo;larrb;lbarr;lbbrk;lbrke;lceil;ldquo;lescc;lhard;lharu;lhblk;llarr;lltri;lneqq;lnsim;loang;loarr;lobrk;lopar;lrarr;lrhar;lrtri;lsime;lsimg;lsquo;ltcir;ltdot;ltrie;ltrif;mDDot;mdash;micro;minus;mumap;nabla;napos;natur;ncong;ndash;neArr;nearr;ngsim;nhArr;nharr;nhpar;nlArr;nlarr;nless;nlsim;nltri;notin;notni;nprec;nrArr;nrarr;nrtri;nsime;nsmid;nspar;nsube;nsucc;nsupe;numsp;nwArr;nwarr;ocirc;odash;oelig;ofcir;ohbar;olarr;olcir;oline;omacr;omega;operp;oplus;orarr;order;ovbar;parsl;phone;plusb;pluse;pound;prcue;prime;prnap;prsim;quest;rAarr;rBarr;radic;rangd;range;raquo;rarrb;rarrc;rarrw;ratio;rbarr;rbbrk;rbrke;rceil;rdquo;reals;rhard;rharu;rlarr;rlhar;rnmid;roang;roarr;robrk;ropar;rrarr;rsquo;rtrie;rtrif;sbquo;sccue;scirc;scnap;scsim;sdotb;sdote;seArr;searr;setmn;sharp;sigma;simeq;simgE;simlE;simne;slarr;smile;sqcap;sqcup;sqsub;sqsup;srarr;starf;strns;subnE;subne;supnE;supne;swArr;swarr;szlig;theta;thkap;thorn;tilde;times;trade;trisb;tshcy;twixt;ubrcy;ucirc;udarr;udhar;uharl;uharr;uhblk;ultri;umacr;uogon;uplus;upsih;uring;urtri;utdot;utrif;uuarr;vBarv;vDash;varpi;vdash;veeeq;vltri;vprop;vrtri;wcirc;wedge;xcirc;xdtri;xhArr;xharr;xlArr;xlarr;xodot;xrArr;xrarr;xutri;ycirc;AacuteAgraveAtildeCcedilEacuteEgraveIacuteIgraveNtildeOacuteOgraveOslashOtildeUacuteUgraveYacuteaacuteagraveatildebrvbarccedilcurrendivideeacuteegravefrac12frac14frac34iacuteigraveiquestmiddotntildeoacuteograveoslashotildeplusmnuacuteugraveyacutefjlig;lates;napid;nbump;nedot;nesim;ngeqq;nleqq;npart;nsubE;nsupE;nvsim;smtes;vnsub;vnsup;%q%x%x%s/%s %s:%v %d %s # %#x ao1990aranesasanteauvernbcizblcisaupcreissdajnkoekavskfonipafonupagascongritalheplocndyukanicardpamakapinyinscousesimpletaraskucrcorulsterunifonunknownnil keyfloat32float64runningconnectlookup writetoUpgradeTrailersocks5hHEADERSReferer flags= len=%d (conn) %v=%v,expiresrefererrefreshtrailerGODEBUGname %q:method:schemeupgrade:statushttp://chunkednosniffCreatedIM UsedCONNECT (trap 19531259765625abortedstoppedsignal TuesdayJanuaryOctoberuam add/healthsuccess.docker.config.my.cnf.pgpass.pypircpostfixmailmandovecotdnsmasqpolkitdproftpdvarnishhaproxyversionconsole[^a-z]+%s://%ssentry-Modulesruntimenum_cpuprofile--dirtySwapperinvaliduintptrChanDir using , type=closure Value>ConvertforcegcallocmWcpuprofallocmRgctraceIO waitsyscallwaitingforevernetworkUNKNOWN:events, goid= s=nil (scan MB in pacer: % CPU ( zombie, j0 = head = ,errno=panic: nmsys= locks= dying= allocsrax rbx rcx rdx rdi rsi rbp rsp r8 r9 r10 r11 r12 r13 r14 r15 rip rflags cs fs gs Signal m->g0= pad1= pad2= text= minpc= value= (scan) types : type answersaccept4tls3desInitialExpiresSubjectcharsetAvestanBengaliBrailleCypriotDeseretElbasanElymaicGranthaHanunooKannadaMakasarMandaicMarchenMultaniMyanmarOsmanyaSharadaShavianSiddhamSinhalaSogdianSoyomboTagalogTibetanTirhutanumber OPTIONS= "`ignoredseconds%w : %wfields.warningVerbose%sErrorEd25519MD5-RSAserial:packageavx512fos/execfips140SHA-224SHA-256SHA-384SHA-512AES-CBCeae_prkderivedcmdline%#x %s debug=1InstAltInstNopalt -> nop -> any -> IN_MOVEIN_OPENUsage: CONNACKPUBLISHPUBCOMPPINGREQ2.5.4.62.5.4.32.5.4.52.5.4.72.5.4.82.5.4.9^[ \t]*ILLEGALCOMMENTdefaultGOAMD64,cryptoGOARM64GOPPC64androidfreebsdriscv64illumosloong64ppc64lesparc64openbsdsolariswindowsenglishdeutschitalianamxtileamxint8amxbf16osxsaveAacute;Abreve;Agrave;Assign;Atilde;Barwed;Bumpeq;Cacute;Ccaron;Ccedil;Colone;Conint;CupCap;Dagger;Dcaron;DotDot;Dstrok;Eacute;Ecaron;Egrave;Exists;ForAll;Gammad;Gbreve;Gcedil;HARDcy;Hstrok;Iacute;Igrave;Itilde;Jsercy;Kcedil;Lacute;Lambda;Lcaron;Lcedil;Lmidot;Lstrok;Nacute;Ncaron;Ncedil;Ntilde;Oacute;Odblac;Ograve;Oslash;Otilde;Otimes;Racute;Rarrtl;Rcaron;Rcedil;SHCHcy;SOFTcy;Sacute;Scaron;Scedil;Square;Subset;Supset;Tcaron;Tcedil;Tstrok;Uacute;Ubreve;Udblac;Ugrave;Utilde;Vdashl;Verbar;Vvdash;Yacute;Zacute;Zcaron;aacute;abreve;agrave;andand;angmsd;angsph;apacir;approx;atilde;barvee;barwed;becaus;bernou;bigcap;bigcup;bigvee;bkarow;bottom;bowtie;boxbox;bprime;brvbar;bullet;bumpeq;cacute;capand;capcap;capcup;capdot;ccaron;ccedil;circeq;cirmid;colone;commat;compfn;conint;coprod;copysr;cularr;cupcap;cupcup;cupdot;curarr;curren;cylcty;dagger;daleth;dcaron;dfisht;divide;divonx;dlcorn;dlcrop;dollar;drcorn;drcrop;dstrok;eacute;easter;ecaron;ecolon;egrave;egsdot;elsdot;emptyv;emsp13;emsp14;eparsl;eqcirc;equals;equest;female;ffilig;ffllig;forall;frac12;frac13;frac14;frac15;frac16;frac18;frac23;frac25;frac34;frac35;frac38;frac45;frac56;frac58;frac78;gacute;gammad;gbreve;gesdot;gesles;gtlPar;gtrarr;gtrdot;gtrsim;hairsp;hamilt;hardcy;hearts;hellip;hercon;homtht;horbar;hslash;hstrok;hybull;hyphen;iacute;igrave;iiiint;iinfin;incare;inodot;intcal;iquest;isinsv;itilde;jsercy;kappav;kcedil;kgreen;lAtail;lacute;lagran;lambda;langle;larrfs;larrhk;larrlp;larrpl;larrtl;latail;lbrace;lbrack;lcaron;lcedil;ldquor;lesdot;lesges;lfisht;lfloor;lharul;llhard;lmidot;lmoust;loplus;lowast;lowbar;lparlt;lrhard;lsaquo;lsquor;lstrok;lthree;ltimes;ltlarr;ltrPar;mapsto;marker;mcomma;midast;midcir;middot;minusb;minusd;mnplus;models;mstpos;nVDash;nVdash;nacute;ncaron;ncedil;nearhk;nequiv;nesear;nexist;nltrie;nprcue;nrtrie;nsccue;nsimeq;ntilde;numero;nvDash;nvHarr;nvdash;nvlArr;nvrArr;nwarhk;nwnear;oacute;odblac;odsold;ograve;ominus;origof;oslash;otilde;otimes;parsim;percnt;period;permil;phmmat;planck;plankv;plusdo;plusdu;plusmn;preceq;primes;prnsim;propto;prurel;puncsp;qprime;rAtail;racute;rangle;rarrap;rarrfs;rarrhk;rarrlp;rarrpl;rarrtl;ratail;rbrace;rbrack;rcaron;rcedil;rdquor;rfisht;rfloor;rharul;rmoust;roplus;rpargt;rsaquo;rsquor;rthree;rtimes;sacute;scaron;scedil;scnsim;searhk;seswar;sfrown;shchcy;sigmaf;sigmav;simdot;smashp;softcy;solbar;spades;sqsube;sqsupe;square;squarf;ssetmn;ssmile;sstarf;subdot;subset;subsim;subsub;subsup;succeq;supdot;supset;supsim;supsub;supsup;swarhk;swnwar;target;tcaron;tcedil;telrec;there4;thetav;thinsp;thksim;timesb;timesd;topbot;topcir;tprime;tridot;tstrok;uacute;ubreve;udblac;ufisht;ugrave;ulcorn;ulcrop;urcorn;urcrop;utilde;vangrt;varphi;varrho;veebar;vellip;verbar;wedbar;wedgeq;weierp;wreath;xoplus;xotime;xsqcup;xuplus;xwedge;yacute;zacute;zcaron;zeetrf;nbumpe;notinE;nparsl;nrarrc;nrarrw;sqcaps;sqcups;vsubnE;vsubne;vsupnE;vsupne;%s %10d%v %v @samplesabl1943akuapemalalc97arevelaarevmdaarkaikabalankabauddhabohoricemodengfonnapagrclassgrmistrhepburnitihasalaukikalemosinltg1929ltg2007metelkomonotonpahawh2pahawh3pahawh4polytonprovencsursilvsutsilvvaidika%s-%s%sGoStringnetedns0[::1]:53continue_gatewayshutdownfile+netinvalid address raw-readsendfilereadfromunixgramfont/ttffont/otfhijackedNO_ERRORPRIORITYSETTINGSLocation data=%q incr=%v ping=%qif-matchlocationhttp/1.1bad_flowpriorityprotocolbad_pathHTTP/2.0%s_%s_%sdisjointoverlapsboundaryHTTP/1.1no-cacheContinueAcceptedConflictsignal: readlink48828125infinitystrconv.parsing ParseIntno anode/uid_map/gid_mapThursdaySaturdayFebruaryNovemberDecember%!Month(uam edituam list/var/log.history_imunifypostgreswww-dataoperatorclamscandiradminproxy-%sfirewallstrategyhttpdumpenvelope%s eventdescribe--alwaysnil PoolFuncTypestruct {scavengepollDescsynctesttraceBufdeadlockraceFinipanicnilcgocheckrunnable is not pointer, errno= packed=BAD RANK status unknown(trigger= npages= nalloc= nfreed=) errno=[signal newval= mcount= bytes, ----- stack=[ minLC= maxpc= stack=[ minutes status= etypes ClassANYQuestiontlsmlkemCurveID(finishedfilenameReceivedif-rangeArmenianBalineseBopomofoBugineseCherokeeCyrillicDuployanEthiopicGeorgianGujaratiGurmukhiHiraganaJavaneseKatakanaKayah_LiLinear_ALinear_BMahajaniOl_ChikiPhags_PaTagbanwaTai_ThamTai_VietTifinaghUgariticVithkuqiNO_PROXYno_proxyomitzeroLogEntrybad inst%-13s %qpositionseconds:CLICOLORPANIC=%vSHA1-RSADSA-SHA1DNS nameCategoryoverflowavx512bwavx512vlgo/typesnet/httpgo/buildMD5+SHA1SHA3-224SHA3-256SHA3-384SHA3-512exporterECDH PCT#fips140CTR_DRBGmemstatsInstFailInstRune[:word:]IN_CLOSEIN_ISDIRdurationUNSUBACKPINGRESPRSV1 setRSV2 setRSV3 setbad MASK2.5.4.102.5.4.112.5.4.17GOMIPS64rva20u64rva22u64.satconv.signextmips64lereadbuf:SHA2-256avx512cdavx512eravx512pfavx512dqSHA2-512Because;Cayleys;Cconint;Cedilla;Diamond;DownTee;Element;Epsilon;Implies;LeftTee;NewLine;NoBreak;NotLess;Omicron;OverBar;Product;UpArrow;Uparrow;Upsilon;alefsym;angrtvb;angzarr;asympeq;backsim;because;bemptyv;between;bigcirc;bigodot;bigstar;boxplus;ccupssm;cemptyv;cirscir;coloneq;congdot;cudarrl;cudarrr;cularrp;curarrm;dbkarow;ddagger;ddotseq;demptyv;diamond;digamma;dotplus;dwangle;epsilon;eqcolon;equivDD;gesdoto;gtquest;gtrless;harrcir;intprod;isindot;larrbfs;larrsim;lbrksld;lbrkslu;ldrdhar;lesdoto;lessdot;lessgtr;lesssim;lotimes;lozenge;ltquest;luruhar;maltese;minusdu;napprox;natural;nearrow;nexists;notinva;notinvb;notinvc;notniva;notnivb;notnivc;npolint;nsqsube;nsqsupe;nvinfin;nwarrow;olcross;omicron;orderof;orslope;pertenk;planckh;pluscir;plussim;plustwo;precsim;quatint;questeq;rarrbfs;rarrsim;rbrksld;rbrkslu;rdldhar;realine;rotimes;ruluhar;searrow;simplus;simrarr;subedot;submult;subplus;subrarr;succsim;supdsub;supedot;suphsol;suphsub;suplarr;supmult;supplus;swarrow;topfork;triplus;tritime;uparrow;upsilon;uwangle;vzigzag;zigrarr;bnequiv;npreceq;nsubset;nsucceq;nsupset;nvltrie;nvrtrie;Time: %vSamples:Mappings--- %v: 1606nict1694acad1959acadbaku1926basicengbiscayanbornholmcolb1945fonkirshfonxsamphognorskhsistemoijekavskivanchovjyutpingkociewielengadocluna1918newfoundoxendictpetr1708scotlandspanglissurmiransynnejyltongyongtunumiitvalenciavalladervecdrukavivaraupwadegilexsistemofiles,dnsdns,filesipv6-icmp_outboundlocalhostattempts:image/bmpimage/gifimage/pngvideo/avifont/woffParseUint[%v = %d]data_flowauthority:protocolwebsocketnet/http.HTTP/1.1 HTTP/1.0 allocmRInternalGC (fractional)write heap dumpasyncpreemptoffforce gc (idle)sync.Mutex.Lockruntime.Goschedmalloc deadlockruntime error: scan missed a gmisaligned maskruntime: min = runtime: inUse=runtime: max = requested skip=bad panic stackrecovery failedmorestack on g0stopm holding pstartm: m has ppreempt SPWRITEmissing mcache?ms: gomaxprocs=randinit missed] morebuf={pc:: no frame (sp=runtime: frame ts set in timertraceback stuckunexpected kindinvalid pointerx509keypairleafrecord overflowbad certificatePKCS1WithSHA256PKCS1WithSHA384PKCS1WithSHA512ClientAuthType(unknown versionclient finishedserver finished#multipartfilesAccept-Language/etc/mime.types()<>@,;:\"/[]?=Hanifi_RohingyaPsalter_PahlaviX-Accel-Expires%-13s %q %qenter reconnectcleaned up subsconnect startedgo.uber.org/zapx509usepoliciesjstmpllitinterptarinsecurepathzipinsecurepath is unavailableinvalid integer0601021504Z0700GET /debug/varsnum_symbols: 1 Unknown profilegeneral failuredata before FINbad close code invalid booleannon-minimal tagunknown Go typeavx512vpopcntdqDiacriticalDot;DoubleRightTee;DownLeftVector;GreaterGreater;HorizontalLine;InvisibleComma;InvisibleTimes;LeftDownVector;LeftRightArrow;Leftrightarrow;LessSlantEqual;LongRightArrow;Longrightarrow;LowerLeftArrow;NestedLessLess;NotGreaterLess;NotLessGreater;NotSubsetEqual;NotVerticalBar;OpenCurlyQuote;ReverseElement;RightTeeVector;RightVectorBar;ShortDownArrow;ShortLeftArrow;SquareSuperset;TildeFullEqual;UpperLeftArrow;ZeroWidthSpace;curvearrowleft;doublebarwedge;downdownarrows;hookrightarrow;leftleftarrows;leftrightarrow;leftthreetimes;longrightarrow;looparrowright;nshortparallel;ntriangleright;rightarrowtail;rightharpoonup;trianglelefteq;upharpoonright;not enough data# Lookups = %d # Mallocs = %d # HeapSys = %d # PauseNs = %d # DebugGC = %v /proc/self/mapscontext canceledhostLookupOrder=/etc/resolv.conf0123456789abcdefnon-IPv4 addressnon-IPv6 addressunknown network no colon on lineHalfClosedRemoteProxy-Connectionapplication/wasmSETTINGS_TIMEOUTFRAME_SIZE_ERRORContent-Encodingcontent-encodingcontent-languagecontent-locationwww-authenticatenil *http.Serverinvalid settingssetting_win_sizestream_went_downover_max_streamsproxy-connectionread_frame_otherUnencryptedHTTP2at offset %d: %w%s %s HTTP/1.1 User-Agent: %s unexpected type unknown locationhost unreachableAlready ReportedMultiple ChoicesPayment RequiredUpgrade RequiredContent-Length: 23841857910156250123456789ABCDEFinvalid argumentinvalid exchangeobject is remotemessage too longno route to hostremote I/O errorstopped (signal)time: bad [0-9]*myimunify statuspermissions listapplication/json.git-credentialssystemd-timesynccpaneleximfilterempty project idContextifyFramesinvalid_argumentSampledUndefined: value of type reflect.MakeFuncinteger overflowgcshrinkstackofftracefpunwindoffGC scavenge waitGC worker (idle)page trace flushSIGNONE: no trap__vdso_getrandom/gc/gogc:percent, not a functiongc: unswept span KiB work (bg), mheap.sweepgen=runtime: nelems=workbuf is emptymSpanList.removemSpanList.insertbad special kindbad summary dataruntime: addr = runtime: base = runtime: head = already; errno= runtime stack: invalid g statusGOTRACEBACK=nonecastogscanstatusbad g transitionschedule: in cgoreflect mismatch untyped locals missing stackmapbad symbol tablenon-Go function pointerless type not in ranges: sigaction failedinvalid dns nameRCodeFormatErrorunpacking headerno renegotiationSignatureScheme(quoted-printableContent-Languagebinary.BigEndianWww-Authenticateinvalid encodingImperial_AramaicMeroitic_CursiveZanabazar_Squareafter object keyregexp: Compile(token is expiredopen sink %q: %wexit startClientWaitTimeout doneConnection lost:received connackincoming startedoutgoing startedunknown protocol* DNS %v GODEBUG: value "TLSv1.3-SHA2-256TLSv1.2-SHA2-256division by zeroInstRuneAnyNotNLIN_CLOSE_NOWRITEConnection Error%s MessageID: %dlength too largeexec: no commandavx512vpclmulqdqCloseCurlyQuote;ContourIntegral;DoubleDownArrow;DoubleLeftArrow;DownRightVector;LeftRightVector;LeftTriangleBar;LeftUpTeeVector;LeftUpVectorBar;LowerRightArrow;NotGreaterEqual;NotGreaterTilde;NotLeftTriangle;OverParenthesis;RightDownVector;ShortRightArrow;UpperRightArrow;bigtriangledown;circlearrowleft;curvearrowright;downharpoonleft;leftharpoondown;leftrightarrows;nLeftrightarrow;nleftrightarrow;ntrianglelefteq;rightleftarrows;rightsquigarrow;rightthreetimes;straightepsilon;trianglerighteq;vartriangleleft;NotHumpDownHump;NotSquareSubset;empty input file # HeapIdle = %d # OtherSys = %d # PauseEnd = %d 0123456789ABCDEFX0123456789abcdefxreflect.Value.Intinvalid stream IDTransfer-EncodingCOMPRESSION_ERRORENHANCE_YOUR_CALMHTTP_1_1_REQUIREDHEADER_TABLE_SIZE; SameSite=StrictIf-Modified-Sinceframe_ping_lengthtruncated headersif-modified-sincetransfer-encodingx-forwarded-protounencrypted_http2bogus greeting %qreset_idle_streaminvalid method %qmissing form bodyX-Idempotency-Keyhttp: nil handlerMoved PermanentlyFailed DependencyToo Many Requestspidfd_send_signal1192092895507812559604644775390625invalid bit size exec format errorpermission deniedno data availablewrong medium typecorrupt zip file fractional secondbroken connectionmalware user listproactive details/usr/local/cpanel^[a-zA-Z0-9_.-]+$marshal error: %w_zapsentry_scope_[^a-zA-Z0-9_/.-]+X-Forwarded-Protodeadline_exceededpermission_deniedGAE_DEPLOYMENT_IDreflect: call of reflect.Value.Lenunknown type kind has invalid namereflect: New(nil)goroutine profileAllThreadsSyscallGC assist markingselect (no cases)sync.RWMutex.Lockwait for GC cycletrace proc statusselect (synctest)SIGINT: interruptSIGBUS: bus errorSIGCONT: continuesync.(*Cond).Wait: missing method notetsleepg on g0bad TinySizeClassruntime: pointer g already scannedmark - bad statusscanobject n == 0swept cached spanmarkBits overflowruntime: summary[runtime: level = , p.searchAddr = futexwakeup addr=, 0, {interval: {ns}}, nil) errno=results: got {r1=runtime/internal/internal/runtime/thread exhaustionlocked m0 woke upentersyscallblock spinningthreads=gp.waiting != nilunknown caller pc, synctest group stack: frame={sp:runtime: nameOff runtime: typeOff runtime: textOff from a write of decryption failedhandshake failureillegal parametermissing extensionunrecognized namemultipartmaxpartsmessage too largeOld_North_ArabianOld_South_Arabianin string literalmemorystore wipedconnect got errorincoming completeSetWriteDeadline keepalive stopped/etc/ssl/cert.peminvalid BMPStringinvalid IA5Stringwinreadlinkvolumeunexpected result060102150405Z0700mlkem: PCT failedindex > windowEnd%%!%c(big.Int=%s)missing closing )missing closing ]Sec-WebSocket-KeySec-Websocket-Key (protocol error)integer too largeexec: killing Cmdexec: not starteddivisor too largeKAS-ECC-SSC P-256DiacriticalAcute;DiacriticalGrave;DiacriticalTilde;DoubleRightArrow;DownArrowUpArrow;EmptySmallSquare;GreaterEqualLess;GreaterFullEqual;LeftAngleBracket;LeftUpDownVector;LessEqualGreater;NonBreakingSpace;NotRightTriangle;NotSupersetEqual;RightTriangleBar;RightUpTeeVector;RightUpVectorBar;UnderParenthesis;UpArrowDownArrow;circlearrowright;downharpoonright;ntrianglerighteq;rightharpoondown;rightrightarrows;twoheadleftarrow;vartriangleright;NotPrecedesEqual;NotSucceedsEqual;NotSucceedsTilde;PeriodType: %s %s%d: %d [%d: %d] @# HeapAlloc = %d # HeapInuse = %d cycles/second=%v truncated profilemalformed profilecontext.Backgroundreflect.Value.Uintserver misbehavinginvalid IP address/etc/nsswitch.confinvalid criteria: http: blank cookiereceived from peerapplication/x-gzipFLOW_CONTROL_ERROR404 page not foundframe_goaway_shortproxy-authenticateUNKNOWN_SETTING_%dconnection is idleunexpected type %Ttrailers_not_endedGo-http-client/2.0Go-http-client/1.1connection refusedTemporary RedirectPermanent RedirectMethod Not AllowedExpectation Failedbad Content-Lengthfield value for %qvalue out of range298023223876953125input/output errorno child processesfile name too longno locks availableidentifier removedmultihop attemptedRFS specific errorstreams pipe erroroperation canceledsegmentation fault: day out of rangeTime.MarshalJSON: Time.MarshalText: unknown time zone missing IAID tokeninvalid IAID tokenIMUNIFY_PROXY_HOSTIMUNIFY_PROXY_PORTIMUNIFY360_API_URLSENTRY_ENVIRONMENTIgnoreTransactionsresource_exhaustedSampledInvalid(%d)HEROKU_SLUG_COMMITreflect.Value.Callreflect.Value.Elemreflect.Value.Typereflect: Zero(nil)unable to parse IPadaptivestackstartdontfreezetheworldtraceadvanceperiodtracebackancestorsgarbage collectionsync.RWMutex.RLockGC worker (active)stopping the worldwait until GC endsbad lfnode addresssystem page size ( but memory size /gc/pauses:seconds because dotdotdotruntime: npages = invalid skip valueruntime: range = {runtime: released=index out of rangeruntime: gp: gp=runtime: getg: g=forEachP: not done in async preempt instruction bytes:mp.gsignal stack [bad manualFreeListruntime: textAddr frames elided... , locked to threadRCodeServerFailureuse of closed fileunexpected messageexport restrictioncannot be negativeinvalid character bufio: buffer fullProxy-Authenticatedecoding error: %vCaucasian_Albanianexceeded max depthin numeric literalchi context value token is malformed15:04:05.000000000internal error: %vmay not contain %qmemorystore closednil CONNACK packetstartComms startedkeepalive startingx509negativeserial/etc/pki/tls/certsinconsistent valueunsupported KDF idunsupported KEM id/debug/pprof/traceserver Unavailableprotocol Violationpermessage-deflate (message too big)non-minimal lengthtruncated sequencesequence truncatedcrypto/rsa: p == qDoubleUpDownArrow;DoubleVerticalBar;DownLeftTeeVector;DownLeftVectorBar;FilledSmallSquare;GreaterSlantEqual;LeftDoubleBracket;LeftDownTeeVector;LeftDownVectorBar;LeftTriangleEqual;NegativeThinSpace;NotReverseElement;NotTildeFullEqual;RightAngleBracket;RightUpDownVector;SquareSubsetEqual;VerticalSeparator;blacktriangledown;blacktriangleleft;leftrightharpoons;rightleftharpoons;twoheadrightarrow;NotGreaterGreater;NotLessSlantEqual;NotNestedLessLess;NotSquareSuperset;# TotalAlloc = %d # Stack = %d / %d # MSpan = %d / %d reflect.Value.IsNilreflect.Value.Floatparsenetlinkmessagecriterion too shortclient disconnectedhttp: Server closedINADEQUATE_SECURITYINITIAL_WINDOW_SIZEframe_data_stream_0 (%d bytes omitted)content-dispositionif-unmodified-sinceproxy-authorizationerr must be non-nilTLS version too lowflow_on_data_lengthheaders_half_closedvalue for header %qhost/path missing /multipart/form-dataContent-Length: 0 non-nil leaf fieldsinvalid header namenetwork unreachableSwitching ProtocolsPrecondition FailedMisdirected RequestService UnavailableConnection: close invalid Trailer key already registeredProxy-Authorizationunknown status code14901161193847656257450580596923828125bad file descriptortoo many open filesdirectory not emptydevice not a streamdisk quota exceededillegal instructionstopped (tty input)bad value for field/usr/lib/locale/TZ//var/lib/imunify360/var/lib/postgresqlfailed_preconditionsync.Cond is copiedreflect.Value.Bytesreflect.Value.Fieldreflect.Value.Indexreflect.Value.Slice are not comparablestrongFromWeakQueueGC mark terminationsync.WaitGroup.WaitSIGTRAP: trace trapwait for debug call__vdso_gettimeofdaycgocall unavailablepanicwrap: no ( in panicwrap: no ) in called using nil *unknown wait reasonnotesleep not on g0GC work not flushedunaligned sysUnused/gc/scan/heap:bytes/gc/heap/goal:bytes/gc/heap/live:bytesbad kind in runfinqmarkroot: bad indexnwait > work.nprocs, gp->atomicstatus=marking free object KiB work (eager), [controller reset]mspan.sweep: state=runtime: heapInUse=runtime: totalFree=sysMemStat overflowbad sequence numberpanic during mallocpanic holding locksmissing deferreturnunexpected gp.parampanic during panic , g->atomicstatus=unexpected g status_cgo_setenv missingbad runtime mstartm not found in allmstopm holding lockssemaRoot rotateLeftbad notifyList sizeruntime: preempt g0runtime: pcdata is zero length segmentRCodeNotImplementedskip this directoryrevoked certificateexpired certificateunknown certificateunknown cipher typeinvalid URL escape missing ']' in hostmultipartmaxheadersContent-Dispositionmime: no media typebinary.LittleEndianevictCount overflowCanadian_AboriginalKhitan_Small_Scriptfile already existsfile does not existfile already closedafter array elementunexpected InstFailattemptReconnectioncalling WaitTimeoutreceived nil packetobound msg to write%v write error: %v x509: malformed OIDx509: trailing datax509: unknown errorgotestjsonbuildtextunknown hash value negative coordinateunsupported AEAD id20060102150405Z0700/debug/pprof/symbolidentifier rejectedConnection Accepted (unsupported data) (abnormal closure) (policy violation)unknown Go type: %vexec: canceling Cmdmodulus must be > 1DownRightTeeVector;DownRightVectorBar;LongLeftRightArrow;Longleftrightarrow;NegativeThickSpace;PrecedesSlantEqual;ReverseEquilibrium;RightDoubleBracket;RightDownTeeVector;RightDownVectorBar;RightTriangleEqual;SquareIntersection;SucceedsSlantEqual;blacktriangleright;longleftrightarrow;NotLeftTriangleBar;parsing profile: %w# %#x %s+%#x %s:%d # HeapObjects = %d # MCache = %d / %d # BuckHashSys = %d # NumForcedGC = %d sampling period=%d invalid key or typeinvalid DNS responseunexpected network: pad length too largehttp2: stream closedhttplaxcontentlengthMAX_HEADER_LIST_SIZEconnection error: %sframe_settings_mod_6No space found in %qsettings_big_or_dupsconn_close_lost_pingassigned stream ID 0read_frame_too_largeinvalid use of queuebad wildcard name %qhttp: POST too largeHTTP/%d.%d %03d %s invalid header valueunknown address typeRequest URI Too LongUnprocessable EntityInsufficient Storage37252902984619140625invalid request codebad font file formatconnection timed outis a named type filekey has been revokedstopped (tty output)urgent I/O conditiontime: invalid number/usr/share/zoneinfo/agent is unreachableget-package-versions/api/v1/mqtt-publishUsername is requiredSitePath is requiredInvalid request body/var/imunify360/iaidssl://localhost:8883MQTT connected to %s%s, sentry_secret=%sinvalid write resultreflect: cannot use returned zero Valuereflect.Value.IsZeroreflect.Value.Methodreflect.Value.SetIntmissing IPv6 addressunexpected characterfloating point errorGC sweep terminationResetDebugLog (test)chan send (nil chan)flushing proc cacheschan send (synctest)SIGALRM: alarm clockSIGTERM: termination__vdso_clock_gettimeclose of nil channelinconsistent lockedmnotetsleep not on g0bad system page size to unallocated span/gc/scan/stack:bytes/gc/scan/total:bytes/gc/heap/frees:bytes/gc/gomemlimit:bytesp mcache not flushed markroot jobs done pacer: assist ratio=workbuf is not emptybad use of bucket.mpbad use of bucket.bpruntime: totalAlloc=runtime: double waitpreempt off reason: forcegc: phase errorgopark: bad g statusgo of nil func valueselectgo: bad wakeupsemaRoot rotateRightreflect.makeFuncStubtrace: out of memorywirep: already in gounknown PSK identitycertificate requiredgzip: invalid headerEgyptian_HieroglyphsMeroitic_Hieroglyphsheader line too longjson: Unmarshal(nil)json: Unmarshal(nil json: error calling signature is invalid%s claim is requiredunknown payload type [%dm%s [0m%s %-44s x509usefallbackrootsgetCert can't be nilinvalid UTF-8 stringx509: malformed spkiinvalid property: %wpkg/tool/linux_amd64X-Sentry-Rate-Limitsunsupported suite IDinvalid integer typeflate: closed writernumber has no digits/debug/pprof/cmdline/debug/pprof/profilereading request: %v expression too largeinvalid repeat countconnection forbiddenSec-Websocket-Accept failed to connect: asn1: syntax error: sentinel error valuesha3: Sum after ReadDoubleLongLeftArrow;DownLeftRightVector;LeftArrowRightArrow;NegativeMediumSpace;RightArrowLeftArrow;SquareSupersetEqual;leftrightsquigarrow;NotGreaterFullEqual;NotRightTriangleBar;no profiles to mergemalformed ELF binary # runtime.MemStats # HeapReleased = %d IMUNIFY_PROXY_API_KEYkey is not comparableunsupported operationreflect.Value.Complexlocalhost.localdomainsingle-request-reopenparsenetlinkrouteattrfeature not supportedhttp: nil Request.URLUNKNOWN_FRAME_TYPE_%dframe_ping_has_streamover_max_streams_racetoo_many_early_resetsRoundTrip failure: %vheader list too largeUnhandled Setting: %vnet/http: nil Contexttoo many Host headershttp: invalid patternSunMonTueWedThuFriSatmalformed Host header%03d status code %d unknown address type command not supportedPrecondition RequiredInternal Server Error186264514923095703125931322574615478515625block device requiredread-only file systempackage not installedlink has been severedstale NFS file handlestate not recoverabletrace/breakpoint trapuser defined signal 1user defined signal 2virtual timer expiredtime zone offset hourbackup-systems statusproactive ignore listRPC agent request: %sInternal server error/var/cache/imunify360VERCEL_GIT_COMMIT_SHAbad type in compare: unknown ABI part kind of unexported methodunexpected value stepreflect.Value.SetZeroreflect.Value.Pointerreflect.Value.SetUintIPv4 address too longunexpected slice sizenegative shift amountdataindependenttimingsystem goroutine wait/gc/heap/allocs:bytesruntime: work.nwait= previous allocCount=, levelBits[level] = runtime: searchIdx = runtime: mappedReady=runtime: totalMapped=defer on system stackpanic on system stackasync stack too large_cgo_unsetenv missingstartm: m is spinningstartlockedm: m has pfindrunnable: wrong ppreempt at unknown pcreleasep: invalid argcheckdead: runnable g from outside bubble runtime: newstack at runtime: newstack sp=runtime: confused by pcHeader.textStart= timer data corruptiondecompression failureunsupported extensionbufio: negative countAnatolian_HieroglyphsInscriptional_Pahlaviafter top-level valuein string escape codetoken is unverifiablestopCommsWorkers doneobound wrote msg, id:invalid NumericStringx509: invalid versionconcurrent map writesmessage limit reachedsimulated PCT failureinvalid named capturewebsocket: close sentSec-WebSocket-VersionSec-Websocket-Versionlen > 125 for controlsequence tag mismatchexec: already startedund af az el lt nl trinvalid scalar lengthcrypto/rsa: p is evenCapitalDifferentialD;DoubleLeftRightArrow;DoubleLongRightArrow;EmptyVerySmallSquare;NestedGreaterGreater;NotDoubleVerticalBar;NotLeftTriangleEqual;NotSquareSubsetEqual;OpenCurlyDoubleQuote;ReverseUpEquilibrium;NotGreaterSlantEqual;malformed profile: %vunknown wire type: %d%s profile: total %d # GCCPUFraction = %v invalid LISTEN_FDS: %sreflectlite.Value.Type.localhost.localdomainmissing ']' in addressinvalid address familyoperation was canceledhttp2: frame too largewrite on closed bufferbody closed by handlerapplication/postscriptDEBUG_HTTP2_GOROUTINESMAX_CONCURRENT_STREAMSframe_data_pad_too_bigaccess-control-max-ageinvalid Trailer key %qinvalid HTTP header %sunexpected empty hpackmalformed HTTP requestmalformed HTTP versionX-Content-Type-OptionsUnsupported Media Type4656612873077392578125argument list too longcannot allocate memoryremote address changedprotocol not availableprotocol not supportedaddress already in usenetwork is unreachable/lib/time/zoneinfo.zipfeature-management getmalware malicious diffmalware malicious listRPC agent response: %sInvalid request format/usr/local/directadminReading secret from %sFile watcher error: %vIMUNIFY_PROXY_MQTT_URLZEIT_GITHUB_COMMIT_SHAZEIT_GITLAB_COMMIT_SHAreflectlite.Value.Elemreflect.Value.MapIndexunexpected method stepreflect.Value.SetFloat to array with length IPv4 address too shortmultiple :: in addressinteger divide by zeroCountPagesInUse (test)ReadMetricsSlow (test)trace reader (blocked)trace goroutine statusGC weak to strong waitSIGSTKFLT: stack faultSIGTSTP: keyboard stopsend on closed channelcall not at safe pointgetenv before env initinterface conversion: freeIndex is not valids.freeindex > s.nelemsbad sweepgen in refillspan has no free spaceruntime: out of memory/gc/scan/globals:bytes/gc/heap/frees:objectsruntime: work.nwait = runtime:scanstack: gp=scanstack - bad statusheadTailIndex overflowruntime: heapReleased=runtime: global value=runtime.main not on m0set_crosscall2 missingbad g->status in readywirep: invalid p stateassembly checks failed received during fork stack not a power of 2minpc or maxpc invalidnon-Go function at pc=skipping Question Nameskipping Question Typeerror decoding messageinappropriate fallbackECDSAWithP256AndSHA256ECDSAWithP384AndSHA384ECDSAWithP521AndSHA512extended master secrethkdf: counter overflow/usr/share/mime/globs2/etc/apache/mime.typesgzip: invalid checksumhpack: string too longheader field %q = %q%sidna: invalid label %qInscriptional_ParthianNyiakeng_Puachue_Hmong into Go struct field json: unknown field %qbuild line missing '='key is of invalid typetoken is not valid yetinvalid type for claimunrecognized level: %qstartCommsWorkers doneSetWriteDeadline to 0 keepalive sending pingunknown field type: %v/etc/ssl/ca-bundle.pemx509: malformed issuerexit hook invoked exitoverflowing coordinateunexpected length codesimulated CAST failureinvalid number base %dinternal inconsistencyerror parsing regexp: Sec-WebSocket-ProtocolSec-Websocket-Protocol (TLS handshake error)FIN not set on controlcontinuation after FIN from SOCKS5 proxy at zero length BIT STRINGcrypto/rsa: p * q != nsha3: Write after ReadCloseCurlyDoubleQuote;DoubleContourIntegral;FilledVerySmallSquare;NegativeVeryThinSpace;NotPrecedesSlantEqual;NotRightTriangleEqual;NotSucceedsSlantEqual;reflectlite.Value.IsNilunexpected address typemissing port in addresshttp2: handler panickedhttp: request too largenet/http: abort Handlertext/xml; charset=utf-8ENABLE_CONNECT_PROTOCOLunknown error code 0x%xframe_goaway_has_streamframe_headers_pad_shortframe_rststream_bad_leninvalid HTTP trailer %snet/http context value unknown relationship %qmalformed HTTP responsemulti wildcard not lastnon-zero reserved fieldnetwork not implementedcommand not implementedVariant Also Negotiates23283064365386962890625operation not permittedinterrupted system calldevice or resource busyno space left on deviceoperation not supportedCPU time limit exceededprofiling timer expiredtime zone offset minutetime zone offset secondMQTT publish failed: %vno authorization headercurrent secret is emptyIMUNIFY_PROXY_LOG_LEVELIMUNIFY_PROXY_POOL_SIZEIMUNIFY_PROXY_IAID_PATHagent/%s/message-statusreflect.Value.Interfacereflect.Value.NumMethodindex out of range [%x]ReadMemStatsSlow (test)runtimecontentionstackschan receive (nil chan)garbage collection scanchan receive (synctest)SIGIO: i/o now possibleSIGSYS: bad system callmakechan: bad alignmentclose of closed channelunlock of unlocked lock) must be a power of 2 system huge page size (runtime: s.allocCount= s.allocCount > s.nelems/gc/heap/allocs:objectsmissing type in runfinqruntime: internal errorwork.nwait > work.nprocleft over markroot jobsgcDrain phase incorrectMB during sweep; swept bad profile stack countruntime: eventfd failedruntime: netpoll failedpanic during preemptoffnanotime returning zerothe current g is not g0schedule: holding locksprocresize: invalid argmisuse of profBuf.writeunexpected signal valuespan has no free stacksstack growth after forkshrinkstack at bad timereflect.methodValueCallunexpected trace readertoo many pointers (>10)segment length too longunpacking Question.Nameunpacking Question.Typeskipping Question Classunsupported certificateno application protocolech accept confirmationCLIENT_TRAFFIC_SECRET_0SERVER_TRAFFIC_SECRET_0QUICEncryptionLevel(%v)missing protocol schemeinvalid URI for requestmultipart: NextPart: %w/etc/apache2/mime.typesbytes.Buffer: too largevarint integer overflowjson: cannot unmarshal into Go value of type unexpected map key typeno keyfunc was providedinternalConnLost calledstopCommsWorkers calledmemorystore initializedUsing MQTT 3.1 protocoloutgoing comms stopping/etc/pki/tls/cacert.peminvalid PrintableStringx509: malformed UTCTimex509: invalid key usagex509: malformed version", missing CPU support exit hook invoked panicpattern bits too long: flate: internal error: failed to compute deltainvalid escape sequenceproxy: unknown scheme: malformed ws or wss URLwebsocket: write closed (invalid payload data)proxy: SOCKS5 proxy at asn1: structure error: truncated tag or lengthunknown GOEXPERIMENT %sEd25519 sign and verifyed25519: bad public keyP224 point not on curveP256 point not on curveP384 point not on curveP521 point not on curvecrypto/rsa: d too smallRSA sign and verify PCTDiacriticalDoubleAcute;NotSquareSupersetEqual;invalid scalar encodingtext/html; charset=utf-8unexpected buffer len=%vinvalid pseudo-header %qframe_headers_prio_shortinvalid request :path %qread_frame_conn_error_%sstream %d already openedapplication/octet-streamPRI * HTTP/2.0 ConnContext returned nilRequest Entity Too Largehttp: nil Request.Header116415321826934814453125582076609134674072265625function not implementedlevel 2 not synchronizedlink number out of rangeout of streams resourcesconnection reset by peerstructure needs cleaningfloating point exceptionfile size limit exceededRawSockaddrAny too small/usr/share/lib/zoneinfo/Failed to generate tokenfailed to sign token: %wReloading JWT secrets...IMUNIFY_PROXY_SENTRY_DSNIMUNIFY_PROXY_SENTRY_ENVMQTT connection lost: %v[^\w\d\s_:/@\.{}\[\]$-]+%s called with nil error%s called with nil event[Sentry] DsnParseError: reflect.StructOf: field address string too shorttracecheckstackownershiphash of unhashable type cannot open standard fdsspan has no free objectsruntime: found obj at *(/cgo/go-to-c-calls:calls/gc/heap/objects:objects/sched/latencies:secondsqueuefinalizer during GCupdate during transitionruntime: markroot index can't scan our own stackgcDrainN phase incorrectpageAlloc: out of memoryruntime: p.searchAddr = range partially overlapsruntime: epollctl failedstack trace unavailable runtime: mp.lockedInt = runqsteal: runq overflowunexpected syncgroup setdouble traceGCSweepStartbad use of trace.seqlockresource length too longunpacking Question.Classerror decrypting messagecertificate unobtainabletls: malformed ECHConfigtls: server rejected ECHinvalid argument to Intnidna: disallowed rune %Ujson: unsupported type: token used before issuedtoken has invalid issuertoken has invalid claimsHMAC sign expects []bytemust start with a letterforcefully disconnectingstartCommsWorkers calledno message IDs availablememorystore get: messagememorystore del: messageUsing MQTT 3.1b protocolmatchAndDispatch exitingFailed to fire hook: %v [%dm%s [0m[%s]%s %-44s x509: malformed validitybaggage-string too largeinvalid ChaCha8 encodinginvalid pattern syntax: flate: maxBits too largestreamSafe was not resetwebsocket: bad handshakewebsocket: write timeoutSec-Websocket-ExtensionsSec-WebSocket-Extensions (internal server error) has unexpected version requires authenticationexec: Stdout already setmissing likely tags dataGODEBUG sys/cpu: value "", required CPU feature chacha20: wrong key sizesha3: invalid hash stateNotNestedGreaterGreater;malformed profile formatFunction ID %d not found%d: %#x/%#x/%#x %s %s %scontext deadline exceededno answer from DNS serverno suitable address foundunexpected '[' in addressunexpected ']' in addresshttp: invalid cookie namehttp2: Request.URI is niltext/plain; charset=utf-8http2: Framer %p: read %vframe_data_pad_byte_shortframe_settings_has_streamframe_headers_zero_streamframe_headers_pad_too_bigframe_priority_bad_lengthhttp2: invalid header: %vstrict-transport-securityhttp2: unsupported schemeread_frame_unexpected_eof{...} wildcard not at endhttp: invalid Host headerHTTP/1.1 100 Continue port number out of range invalid username/password/proc/sys/kernel/hostname2910383045673370361328125no such file or directoryno such device or addressinvalid cross-device linkresource deadlock avoidedsocket type not supportedno buffer space availableoperation now in progress2006-01-02T15:04:05Z07:00failed to marshal requestconnection pool is closedFailed to execute commandFailed to publish messageIMUNIFY_PROXY_SOCKET_PATHZEIT_BITBUCKET_COMMIT_SHAreflect.Value.SetMapIndexreflect: Bits of nil Typereflect.StructOf: field "reflect.Value.OverflowIntIPv4 field has value >255goroutine profile cleanupchansend: spurious wakeup when attempting to open runtime lock: lock countbad system huge page sizearena already initialized to unused region of spanunaligned sysNoHugePageOS/sched/gomaxprocs:threadsremaining pointer buffersruntime: epollwait on fd slice bounds out of range_cgo_thread_start missingallgadd: bad status Gidleruntime: program exceeds startm: p has runnable gsstoplockedm: not runnablereleasep: invalid p statecheckdead: no p for timercheckdead: no m for timerunexpected fault address missing stack in newstackbad status in shrinkstackmissing traceGCSweepStartinconsistent poll.fdMutextls: protocol is shutdownnet/url: invalid userinfoContent-Transfer-Encodingjson: Unexpected key typejson: unsupported value: not at beginning of valuetoken has invalid subjectno encoder name specifiedinternalConnLost completeUsing MQTT 3.1.1 protocolx509: invalid RDNSequencex509: invalid RSA modulusx509: malformed extensionx509: malformed signatureinvalid retry-after valueGODEBUG: can not enable "testing simulated failureattachment; filename="%s"failed to collect profilebad user name or passwordunknown Go type for sliceexplicit tag has no childinvalid object identifiercrypto/rsa: invalid primeClockwiseContourIntegral;DoubleLongLeftRightArrow;decompressing profile: %vreflect.Value.CanInterfacecannot marshal DNS messagetoo many colons in addressunclosed criterion bracketcriterion lacks equal signhttp: invalid cookie valueread from empty dataBuffernet/http: request canceledstopped after 10 redirectsduplicate pseudo-header %qhttp2: Framer %p: wrote %vframe_windowupdate_bad_lenframe_priority_zero_streaminternal error: bad Writerhttp2: invalid Host headerduplicate wildcard name %qliterals differ: %q and %qmalformed HTTP status codeaddress type not supportedHTTP Version Not SupportedreadLoopPeekFailLocked: %w1455191522836685180664062572759576141834259033203125no message of desired typeno CSI structure availableinvalid request descriptorname not unique on networkrequired key not available: day-of-year out of rangeinvalid or missing api key/var/imunify360/iaid-tokenhttps://api.imunify360.comempty IAID, cannot publishIntegration installed: %s Using release from Git: %s using unaddressable valueempty buffer in CopyBufferunknown ABI parameter kind using zero Value argumentreflect.Value.MethodByNamereflect.Value.OverflowUintall goroutines stack traceSIGSTOP: stop, unblockableGC background sweeper waitcall from unknown functionnotewakeup - double wakeuppersistentalloc: size == 0/gc/cycles/total:gc-cyclesnegative idle mark workersuse of invalid sweepLockerruntime: bad span s.state=runtime: consistent value=forEachP: P did not run fnwakep: negative nmspinningstartlockedm: locked to meinittask with no functionscorrupted semaphore ticketout of memory (stackalloc)shrinking stack in libcallruntime: pcHeader: magic= tracing is already enabledtraceRegion: out of memoryruntime: got trace reader segment prefix is reservedbad certificate hash valueECDSA verification failureinvalid port %q after host/etc/httpd/conf/mime.typesinvalid argument to Int63ninvalid argument to Int31nid (%v) <= evictCount (%v)malformed chunked encodinginvalid CR in chunked lineencountered a cycle via %stoken signature is invalidtoken has invalid audienceHMAC verify expects []bytemust specify logging levelmalformed request body: %vsocket connected to brokerresume exiting due to stoploaded pending pubrel (%d)Using MQTT 3.1.1b protocolstartIncomingComms started [%dm%s [0m[%04d]%s %-44s x509: malformed parametersx509: malformed extensionscrypto/rsa: prime P is nilcrypto/rsa: prime Q is nilcryptobyte: internal errormlkem: invalid seed length

server_no_context_takeoverclient_no_context_takeoverbase 128 integer too largetruncated base 128 integerasn1: invalid UTF-8 stringnon sequence tagged as set([A-Z][A-Z]+)\(([^)]+)\):?ed25519: invalid signaturechacha20: wrong nonce sizechacha20: counter overflowstring_table[0] must be ''pprof: use of zero Profilenet/http: use last responsehttpservecontentkeepheadersinvalid dependent stream IDhttp2: response body closednet/http: request completedDATA frame with stream ID 0frame_rststream_zero_streamframe_pushpromise_pad_shortaccess-control-allow-originhttp2: server read frame %vignoring invalid trailer %qinvalid WriteHeader code %vadd DATA on non-open streamnet/http: invalid method %qnet/http: invalid header %sunsupported protocol schemeos: unsupported signal typeos: process not initialized363797880709171295166015625channel number out of rangecommunication error on sendnot a XENIX named type filekey was rejected by servicemalware on-demand list-userwordpress-plugin list-sitesToken validation failed: %vreflectlite.Value.Interfacereflectlite.Value.NumMethod is not assignable to type reflect.Value.UnsafePointerIPv6 field has value >=2^16PageCachePagesLeaked (test)SIGILL: illegal instructionSIGXCPU: cpu limit exceededcgoUse should not be calledmakechan: size out of rangeG waiting list is corruptedM structure uses sizeclass runtime unlock: lock countprogToPointerMask: overflow/gc/cycles/forced:gc-cycles/memory/classes/other:bytes/memory/classes/total:bytesfailed to set sweep barrierwork.nwait was > work.nproc not in stack roots range [allocated pages below zero?address not a stack addressmspan.sweep: bad span stateinvalid profile bucket typeruntime: corrupted polldescruntime: netpollinit failedruntime: asyncPreemptStack=runtime: thread ID overflowstopTheWorld: holding locksgcstopm: not waiting for gcruntime: checkdead: nmidle=runtime: checkdead: find g runlock of unlocked rwmutexsignal received during forksigsend: inconsistent statemakeslice: len out of rangemakeslice: cap out of rangegrowslice: len out of rangestack size not a power of 2timer when must be positive: unexpected return pc for insufficient security levelCurveP256CurveP384CurveP521cryptobyte: length overflowtls: short read from Rand: hrr ech accept confirmationhttp chunk length too largeabi.NewName: tag too long: after object key:value pairbuild line with missing keyed25519: verification errorcould not JSON decode claimno sink found for scheme %qcan't parse %q as a URL: %vReconnect failed, slept forset deadline for handshake %s MessageID: %d topics: %sloaded pending publish (%d)startComms closing outErrorFailed to write to log, %v not a valid logrus level %dunsupported string type: %vx509: malformed certificatex509: no valid chains builtcurrent time %s is after %sinvalid baggage list-memberinvalid ASN.1 from SignASN1boringcrypto: not availablecipher: incorrect length IVReuse of exported var name:expression nests too deeply rejected username/passwordinvalid P224 point encodinginvalid P256 point encodinginvalid P384 point encodinginvalid P521 point encodinginput overflows the modulusinconsistent mapping %p: %dNAF digits must fit in int8Failed to notify systemd: %verrors: target cannot be nilcannot unmarshal DNS message/proc/sys/net/core/somaxconnhttp2: client conn is closedtext/plain; charset=utf-16betext/plain; charset=utf-16leapplication/x-rar-compressedinvalid header field name %qhttp2: header list too largeaccess-control-allow-headersaccess-control-allow-methodsforgetting unknown stream idhttp2: Transport received %shttp: request body too largeunsupported protocol versionmissing required Host headerunexpected protocol version general SOCKS server failureTransfer-Encoding: chunked invalid empty Content-Lengthnet/http: invalid trailer %shttp: no Host in request URLos: process already finishedos: process already released18189894035458564758300781259094947017729282379150390625protocol driver not attachedfile descriptor in bad statedestination address requiredunsupported compression for failed to unmarshal responseError closing connection: %vFailed to generate token: %vinvalid authorization formatFailed to reload secrets: %v/var/imunify360/.sentry_tagsIMUNIFY_PROXY_LOG_FILE_PATHSIMUNIFY_PROXY_SENTRY_FIRST_Nevent could not be marshaledBuffer flushed successfully.Release detection failed: %vreflect.MakeSlice: len > capSIGHUP: terminal line hangupSIGWINCH: window size changeGC mark assist wait for workcomparing uncomparable type runtime: bad lfnode address notewakeup - double wakeup (region exceeds uintptr range/gc/heap/frees-by-size:bytes/gc/heap/tiny/allocs:objects/sched/goroutines:goroutinesgcBgMarkWorker: mode not setmspan.sweep: m is not lockedfound pointer to free objectmheap.freeSpanLocked - span fatal: morestack on gsignal runtime: casgstatus: oldval=gcstopm: negative nmspinningfindrunnable: netpoll with psave on system g not allowednewproc1: newg missing stacknewproc1: new g is not GdeadnewProfBuf: buffer too largeFixedStack is not power-of-2missing stack in shrinkstack args stack map entries for invalid runtime symbol tableruntime: no module data for mismatched isSending updates[originating from goroutine traceRegion: alloc too largetls: malformed ECHConfigListEd25519 verification failuremultipart: message too largemultipart: boundary is emptymalformed MIME header line: /usr/local/share/mime/globs2bytes: negative Repeat countinvalid byte in chunk lengthinvalid proxy address %q: %vabi.NewName: name too long: json: Unmarshal(non-pointer !#$%&()*+-./:;<=>?@[]^_{|}~ unexpected end of JSON inputchi: replacing missing childsigning method %v is invalidcould not JSON decode header%q is not a valid scheme: %vIgnored key without a value.Connect failed, sleeping forresume found NIL packet (%s)putting pubrec msg on oboundputting puback msg on oboundFailed to obtain reader, %v not a valid logrus Level: %qcan't unmarshal a nil *Level2006-01-02T15:04:05.000Z0700x509: invalid RSA public keyx509: invalid DSA public keyx509: invalid DSA parametersx509: negative serial numbercurrent time %s is before %scrypto/rsa: decryption errorcrypto/aes: counter overflowpending ASN.1 child too longbig: misuse of expNNWindowedattachment; filename="trace"Could not enable tracing: %sfailed to read expected dataunsupported packet type 0x%xasn1: string not valid UTF-8DetECDSA P-256 SHA2-512 signfips140: verified code+data inconsistent function %p: %dcpu profiling already in useinvalid P224Element encodinginvalid P384Element encodinginvalid P521Element encodingfailed to define hostname: %vFailed to create listener: %vmismatched local address typeunknown IP protocol specifiedhttp: '=' not found in cookiewrite on uninitialized bufferhttp2: client conn not usableMon, 02 Jan 2006 15:04:05 GMTapplication/vnd.ms-fontobjecthttp: idle connection timeoutMon, 02 Jan 2006 15:04:05 MSTMon, 02-Jan-2006 15:04:05 MSTinternal error: took too muchframe_pushpromise_zero_streamframe_pushpromise_pad_too_bigaccess-control-expose-headersaccess-control-request-methodhttp2: client connection lostHTTP/1.1 %d %s: %s%s%d %s: %shttp: panic serving %v: %v %sNon-Authoritative InformationProxy Authentication RequiredUnavailable For Legal Reasonsdup idle pconn %p in freelist45474735088646411895751953125too many open files in systemnumerical result out of rangemachine is not on the networkprotocol family not supportedoperation already in progressno XENIX semaphores availableTime.UnmarshalBinary: no datamalware on-demand status-userwordpress-plugin rules enableFailed to execute command: %vMQTT publisher not configuredunexpected signing method: %vRead current secret: %d bytesFile change detected: %s (%s)IMUNIFY_PROXY_COMMAND_TIMEOUTIMUNIFY_PROXY_IAID_TOKEN_PATHapplication/x-sentry-envelopeio: read/write on closed pipereflect: Key of non-map type cannot be converted to type SIGPIPE: write to broken pipeSIGPWR: power failure restartexecuting on Go runtime stackruntime: mmap: access denied /cpu/classes/idle:cpu-seconds/cpu/classes/user:cpu-seconds/gc/heap/allocs-by-size:bytes/gc/stack/starting-size:bytesgc done but gcphase != _GCoffruntime: p.gcMarkWorkerMode= scanobject of a noscan objectruntime: marking free object addspecial on invalid pointerruntime: summary max pages = runtime: levelShift[level] = doRecordGoroutineProfile gp1=runtime: eventfd failed with tried to unpin non-Go pointerruntime: sudog with non-nil centersyscall inconsistent bp entersyscall inconsistent sp gfput: bad status (not Gdead)LockOSThread nesting overflowsemacquire not on the G stackruntime: split stack overflowstring concatenation too longinvalid function symbol tabletrace: reading after shutdownruntime: traceback stuck. pc=tried to trace dead goroutineruntime: impossible type kindunknown certificate authoritytls: too many ignored recordstls: invalid NextProtos valuetls: invalid server key sharemime: invalid media parameterbufio.Scanner: token too longchi/middleware context value error while executing keyfunccould not base64 decode claimfsnotify: not a directory: %qFailed to connect to a brokerdialer was nil, using defaultincoming comms goroutine donepublish was broken by timeoutloaded pending subscribe (%d)loaded pending incomming (%d)x509: unsupported time formatx509: cannot parse URI %q: %sx509: malformed serial numberx509: cannot parse dnsName %qcrypto/aes: invalid key size crypto/des: invalid key size crypto/rc4: invalid key size FIPS 140-3 self-test failed: FIPS 140-3 self-test passed: invalid character class rangeunacceptable protocol versioninteger not minimally-encodedzero length OBJECT IDENTIFIER20060102150405.999999999Z0700pkcs12: odd-length BMP stringexec: Wait was already calledinvalid P256 element encodingcrypto/rsa: |p - q| too smallHTTP server shutdown error: %vstream error: stream ID %d; %vframe_settings_ack_with_lengthillegal window increment valueHEADERS frame with stream ID 0frame_continuation_zero_streamhttp2: decoded hpack field %+vrunning on the wrong goroutineaccess-control-request-headershttp2: panic serving %v: %v %spersistConn was already in LRU227373675443232059478759765625strings: negative Repeat countinappropriate ioctl for devicesocket operation on non-socketprotocol wrong type for socketyear outside of range [0,9999]wordpress-plugin rules disableinvalid characters in usernameStopping SecretManager watcherIMUNIFY_PROXY_SENTRY_TAGS_PATHgithub.com/getsentry/sentry-gocalled entry on non-entry nodereflect: Elem of invalid type reflect: Len of non-array typeMapIter.Key called before Nexttrailing garbage after addressassignment to entry in nil mapSIGUSR1: user-defined signal 1SIGUSR2: user-defined signal 2SIGVTALRM: virtual alarm clockSIGPROF: profiling alarm clockruntime: bad g in cgocallback (types from different scopes)failed to get system page sizeruntime: found in object at *( in prepareForSweep; sweepgen /cpu/classes/total:cpu-seconds/gc/cycles/automatic:gc-cycles/sched/pauses/total/gc:seconds/sync/mutex/wait/total:seconds/godebug/non-default-behavior/runtime: totalMapped-released=runtime: epollctl failed with panic called with nil argumentcheckdead: inconsistent countsrunqputslow: queue is not fullruntime: bad pointer in frame invalid pointer found on stack locals stack map entries for abi mismatch detected between runtime: impossible type kind unsafe.Slice: len out of rangeprotocol version not supportedmissing validateFirstLine funcmime: duplicate parameter namechunked line ends with bare LFlooking for beginning of valuein exponent of numeric literalunquoted key %q must be quotedcould not base64 decode headerMultiple errors without a key.status is already disconnectedabout to write new connect msgstartIncoming Received Messagex509: invalid ECDSA parametersx509: SAN dNSName is malformedx509: malformed issuerUniqueIDsync: inconsistent mutex statesync: unlock of unlocked mutexGODEBUG: unknown cpu feature "crypto/rsa: verification errorcrypto/cipher: counter wrappedcrypto/ecdh: mismatched curvesfips: invalid self-test name: attachment; filename="profile"subtle.XORBytes: dst too shortwebsocket: read limit exceeded (mandatory extension missing)transform: short source bufferasn1: cannot marshal nil valuefips140: verification mismatchUsing systemd socket activationfmt: unknown base; can't happenhttp2: connection error: %v: %vframe_headers_prio_weight_shortPRIORITY frame with stream ID 0too many authentication methodsRequested Range Not SatisfiableRequest Header Fields Too LargeNetwork Authentication Requiredtoo many transfer encodings: %qnet/http: TLS handshake timeoutpattern contains path separator11368683772161602973937988281255684341886080801486968994140625.lib section in a.out corruptedcannot assign requested addressmalformed time zone informationwordpress-plugin list-incidentsinvalid connection type in poolIMUNIFY_PROXY_SENTRY_THEREAFTERFailed to read sentry tags filereflect: Len of non-array type reflect.MakeSlice: negative lenreflect.MakeSlice: negative capzone must be a non-empty stringslice bounds out of range [:%x]slice bounds out of range [%x:]SIGSEGV: segmentation violationcall from within the Go runtimeinternal error - misuse of itab) not in usable address space: runtime: cannot allocate memorycheckmark found unmarked object/memory/classes/heap/free:bytes/memory/classes/os-stacks:bytespacer: sweep done at heap size non in-use span in unswept listruntime.Pinner: argument is nilcasgstatus: bad incoming valuesresetspinning: not a spinning mruntime: profBuf already closedfatal: bad g in signal handler signal_recv: inconsistent stateruntime: split stack overflow: ...additional frames elided... unsafe.String: len out of rangeinvalid return from write: got bad certificate status responseencrypted client hello requiredtls: unsupported public key: %TTLS: sequence number wraparoundCLIENT_HANDSHAKE_TRAFFIC_SECRETSERVER_HANDSHAKE_TRAFFIC_SECRETtls: failed to sign handshake: json: invalid number literal %qin literal true (expecting 'r')in literal true (expecting 'u')in literal true (expecting 'e')in literal null (expecting 'u')in literal null (expecting 'l')expected colon after object keyexpected 2 or 3 columns; got %dmergeRuneSets odd length []runetoken is missing required claimcould not parse NumericData: %wOnly GET and PUT are supported.client is connected/reconnectedsending publish message, topic:loaded pending unsubscribe (%d)logic waiting for msg on iboundx509: malformed GeneralizedTimecrypto/ecdh: invalid public keyx509: invalid basic constraintsx509: malformed tbs certificatex509: malformed subjectUniqueIDx509: certificate is valid for %d chains with invalid policies* Connection local=%v remote=%vecdsa: signature did not verifycrypto/rsa: prime factor is nilcrypto/aes: len(dst) < len(src)writeBytes with unfinished bitsapplication/json; charset=utf-8attachment; filename="%s-delta"ecdsa: reseed interval exceededed25519: bad signature length: missing sample type informationca-ES-valencia en-US-u-va-posixtabwriter: panic during %s (%v)Sentry initialization failed: %vUnable to add sentry handler: %vgo package net: hostLookupOrder(frame_windowupdate_zero_inc_connaccess-control-allow-credentialshttp2: server ignoring frame: %vread limit of %d bytes exhaustedpidStatus called in invalid mode28421709430404007434844970703125resource temporarily unavailablenumerical argument out of domainsoftware caused connection abort: day-of-year does not match dayError reading secret from %s: %vReceived fsnotify event: %s (%s)/var/log/imunify-agent-proxy.logFailed to parse sentry tags JSONsync: Unlock of unlocked RWMutexsync: negative WaitGroup counterMapIter.Value called before Nextreflect.Value.Grow: negative lenunexpected character, want colonslice bounds out of range [::%x]slice bounds out of range [:%x:]slice bounds out of range [%x::]SIGFPE: floating-point exceptionSIGTTOU: background write to tty (types from different packages)end outside usable address spaceruntime: fixalloc size too largeinvalid limiter event type foundscanstack: goroutine not stoppedscavenger state is already wiredsweep increased allocation countremovespecial on invalid pointergetWeakHandle on invalid pointerruntime: root level max pages = _cgo_pthread_key_created missingruntime: sudog with non-nil elemruntime: sudog with non-nil nextruntime: sudog with non-nil prevruntime: mcall function returnednon-Go code disabled sigaltstackruntime: newstack called from g=runtime: stack split at bad timepanic while printing panic valueuse of closed network connectionchacha20poly1305: bad key lengthtls: unknown Renegotiation valuetls: NextProtos values too largetls13: label or context too longmime: expected token after slashbufio: invalid use of UnreadBytebufio: tried to fill full bufferin literal false (expecting 'a')in literal false (expecting 'l')in literal false (expecting 's')in literal false (expecting 'e')invalid quoted key in build linebuild line missing '=' after keyunquoted value %q must be quotedcrypto/ecdsa: verification errorRSA sign expects *rsa.PrivateKeyfsnotify: watcher already closedFSNOTIFY_DEBUG: %s AddWith(%q) no servers defined to connect tointernalConnLost workers stoppedstartIncomingComms: granted qossoutgoing obound reporting error /etc/pki/tls/certs/ca-bundle.crtx509: unsupported elliptic curvex509: invalid constraint value: x509: malformed subjectPublicKeyx509: cannot parse rfc822Name %qx509: ECDSA verification failureinitial table capacity too large" not supported for cpu option "ecdsa: internal error: r is zeroecdsa: internal error: s is zeroed25519: bad public key length: crypto/rsa: public key missing Ncrypto/rsa: prime factor is <= 1crypto/des: input not full blockcrypto/aes: input not full blockcrypto/cipher: counter decreasedmlkem: invalid ciphertext lengthcrypto/ecdh: invalid private keysubtle.XORBytes: invalid overlapwebsocket: invalid control frameproxy: got unknown address type integer is not minimally encodedcannot represent time as UTCTimecrypto/rsa: invalid CRT exponentinput overflows the modulus sizechacha20: invalid buffer overlapCounterClockwiseContourIntegral;found mapping with reserved ID=0language: tag is not well-formed--- go package net: confVal.netCgo = pseudo header field after regularhttp: invalid Read on closed Bodynet/http: skip alternate protocolhttp: CloseIdleConnections calledapplication/x-www-form-urlencodedinvalid header field value for %qpad size larger than data payloadframe_pushpromise_promiseid_shorthttp2: invalid pseudo headers: %vtimeout waiting for PING responsehttp: multiple registrations for invalid concurrent Body.Read callconnection not allowed by rulesetinvalid username/password versionunsupported transfer encoding: %qrelease of handle with refcount 0142108547152020037174224853515625710542735760100185871124267578125too many levels of symbolic linksunix socket %s does not exist: %wMissing claims in request contextJWT secrets reloaded successfullySending %s [%s] to %s project: %sCODEBUILD_RESOLVED_SOURCE_VERSIONUsing release from debug info: %sbytes.Buffer.Grow: negative countreflect: slice index out of rangesync: RUnlock of unlocked RWMutex of method on nil interface valuereflect: Field index out of rangereflect: array index out of rangereflect.Value.Equal: invalid Kind to pointer to array with length slice bounds out of range [%x:%y]SIGCHLD: child status has changedSIGTTIN: background read from ttySIGXFSZ: file size limit exceededbase outside usable address spaceruntime: memory allocated by OS [misrounded allocation in sysAlloc/cpu/classes/gc/pause:cpu-seconds/cpu/classes/gc/total:cpu-seconds/gc/limiter/last-enabled:gc-cycle/memory/classes/heap/stacks:bytes/memory/classes/heap/unused:bytes/sched/pauses/stopping/gc:seconds/sched/pauses/total/other:secondsmin must be a non-zero power of 2runtime: failed mSpanList.insert runtime: epollcreate failed with runtime: morestack on g0, stack [runtime: castogscanstatus oldval=stoplockedm: inconsistent lockingfindrunnable: negative nmspinningfreeing stack not in a stack spanstackalloc not on scheduler stackruntime: goroutine stack exceeds runtime: text offset out of rangetimer period must be non-negativetoo many concurrent timer firingsruntime: name offset out of rangeruntime: type offset out of rangetoo many Answers to pack (>65535)skip everything and stop the walkwaiting for unsupported file typetls: failed to write to key log: tls: invalid server finished hashtls: unexpected ServerKeyExchangeempty hex number for chunk lengthcould not base64 decode signatureRSA verify expects *rsa.PublicKeyno encoder registered for name %qdisconnection already in progressstatus is already Connection Lostreceived msg that was not CONNACKnon-CONNACK first packet receivedoutgoing oboundp reporting error done putting pubrec msg on obounddone putting puback msg on oboundgithub.com/TheZeroSlave/zapsentryx509: invalid RSA public exponentx509: SAN rfc822Name is malformedx509: invalid extended key usagesconcurrent map read and map writetable must have positive capacityGODEBUG: no value specified for "crypto: requested hash function #crypto/des: output not full blockcrypto/aes: output not full blockleafCounts[maxBits][maxBits] != nregexp: unhandled case in compilewebsocket: bad write message typeproxy: port number out of range: indefinite length found (not DER)struct contains unexported fieldslanguage: unsupported set type %TSCGQUUSGSCOMPRKCYMSPMSRBATFMYTATNSigEd25519 no Ed25519 collisions SigEd25519 no Ed25519 collisions GODEBUG sys/cpu: can not enable "sha3: invalid hash state functionfound function with reserved ID=0found location with reserved id=0scalar has high bit set illegallytimeout waiting for client prefacehttp2: aborting request body writehttp: connection has been hijackedhttp: persistConn.readLoop exitinghttp: read on closed response bodystream error: stream ID %d; %v; %vframe_settings_window_size_too_bigframe_windowupdate_zero_inc_streamnewWriterAndRequestNoBody(%+v): %v%s matches the same requests as %shttp: invalid Content-Length of %qBaseContext returned a nil contextunsupported authentication method 3552713678800500929355621337890625too many references: cannot splice: day-of-year does not match monthSuccessfully read %d bytes from %sIMUNIFY_PROXY_SENTRY_SAMPLE_PERIODIMUNIFY_PROXY_ZAP_SAMPLING_INITIALreflect: Method index out of rangereflect: Field of non-struct type reflect: Field index out of boundsreflect.FuncOf: too many argumentsreflect.StructOf: duplicate field " is anonymous but has PkgPath setreflect: string index out of rangereflect.Value.Grow: slice overflowslice bounds out of range [:%x:%y]slice bounds out of range [%x:%y:]SIGURG: urgent condition on socketruntime: standard file descriptor out of memory allocating allArenas/memory/classes/heap/objects:bytesruntime.SetFinalizer: cannot pass too many pages allocated in chunk?mspan.ensureSwept: m is not lockedruntime: netpollBreak write failedforEachP: sched.safePointWait != 0schedule: spinning with local workentersyscallblock inconsistent bp entersyscallblock inconsistent sp runtime: g is running but p is notinvalid timer channel: no capacityexpected an RSA public key, got %Ttls: malformed key_share extensionTLS 1.3, server CertificateVerify TLS 1.3, client CertificateVerify illegal base64 data at input byte bytes: Join output length overflowin \u hexadecimal character escapeexpected comma after array elementinvalid quoted value in build lineEd25519 sign expects crypto.Signerfsnotify: queue or buffer overflownotify: short read in readEvents()stopCommsWorkers waiting for commsobound priority msg to write, type/etc/ssl/certs/ca-certificates.crtadding nil Certificate to CertPoolx509: unknown public key algorithmx509: invalid certificate policies%s %q is excluded by constraint %qx509: Ed25519 verification failurex509: unhandled critical extensioncrypto/rsa: missing public moduluscrypto/des: invalid buffer overlapcrypto/aes: invalid buffer overlapcrypto/rc4: invalid buffer overlapCould not enable CPU profiling: %sinvalid nested repetition operatorinvalid or unsupported Perl syntaxsemaphore: released more than heldConnection Refused: Not Authorisedinvalid padding bits in BIT STRINGinvalid GOWASM: no such feature %qexecutable file not found in $PATHcrypto/rsa: public modulus is evenGODEBUG sys/cpu: can not disable "chacha20: wrong HChaCha20 key sizemultiple mappings with same id: %dHTTP server shut down successfully.Failed to create secret manager: %vhttp: server closed idle connectionCONTINUATION frame with stream ID 0Prohibited TLS 1.2 Cipher Suite: %xhttp2: server: client %v said hellohttp2: server processing setting %vWrite called after Handler finished2006-01-02T15:04:05.999999999Z07:00os/signal: Notify using nil channel1776356839400250464677810668945312588817841970012523233890533447265625ryuFtoaFixed32 called with prec > 9network dropped connection on resettransport endpoint is not connectednon-positive interval for NewTickerfailed to create new connection: %wInvalid request body: %v, error: %vUser param is not a string: user=%s/etc/imunify-agent-proxy/jwt-secret" is unexported but missing PkgPathreflect.MakeSlice of non-slice typepersistentalloc: align is too large/memory/classes/heap/released:bytesgreyobject: obj not pointer-alignedmismatched begin/end of activeSweepmheap.freeSpanLocked - invalid freefailed to get or create weak handleattempt to clear non-empty span setruntime: close polldesc w/o unblockruntime: inconsistent read deadlinefindrunnable: netpoll with spinningpidleput: P has non-empty run queuetraceback did not unwind completelytoo many Questions to pack (>65535)file type does not support deadlineunsupported signature algorithm: %vtls: too many non-advancing recordstls: server selected an invalid PSKmime: bogus characters after %%: %qgzip: invalid compression level: %dgzip.Write: Extra data is too largehpack: invalid Huffman-encoded datadynamic table size update too largesigning method (alg) is unavailablesigning method (alg) is unspecifiedmissing EncodeTime in EncoderConfigseconds and will then retry, error:reset deadline following handshake internalConnLost waiting on workersstopCommsWorkers done (not running)A lookup for token %d returned nil startIncomingComms: ibound completex509: malformed extension OID fieldx509: wrong Ed25519 public key sizex509: invalid authority info accessecdsa: invalid signature: r is zeroecdsa: invalid signature: s is zerocrypto/rsa: invalid PSS salt lengthcrypto/md5: invalid hash state sizeflate: corrupt input before offset '_' must separate successive digitsFSNOTIFY_DEBUG: %s %-30s %s%q invalid utf8 payload in close frametransform: short destination buffersuperfluous leading zeros in lengthP224 point is the point at infinityP256 point is the point at infinityP384 point is the point at infinityP521 point is the point at infinitycrypto/rsa: invalid CRT coefficientcrypto/rsa: public exponent is evenbigmod: modulus is smaller than natbigmod: modulus for Exp must be oddchacha20: output smaller than inputsha3: invalid hash state identifierincompatible period types %v and %vincompatible sample types %v and %vmultiple functions with same id: %dmultiple locations with same id: %druntime/pprof: converting profile: mismatched profile records and tagshttp: unexpected EOF reading trailer LastStreamID=%v ErrCode=%v Debug=%qhttp2: server rejecting conn: %v, %sHeader called after Handler finishedRoundTrip retrying after failure: %vJanFebMarAprMayJunJulAugSepOctNovDecno acceptable authentication methodspidDeactivate called in invalid mode444089209850062616169452667236328125ryuFtoaFixed64 called with prec > 180123456789abcdefghijklmnopqrstuvwxyzstrings.Builder.Grow: negative countstrings: Join output length overflowaccessing a corrupted shared libraryTime.UnmarshalBinary: invalid lengthwordpress-plugin rules list-disabledpath traversal detected in site_pathIntegration %s is already installed Event dropped due to SampleRate hit.Buffer flushing reached the timeout.reflect: NumField of non-struct typemethod ABI and value ABI don't alignreflect.Value.Equal: values of type lfstack node allocated from the heap) is larger than maximum page size (runtime: invalid typeBitsBulkBarrieruncaching span but s.allocCount == 0/memory/classes/metadata/other:bytes/sched/pauses/stopping/other:secondsuser arena span is on the wrong listruntime: marked free object in span runtime: unblock on closing polldescruntime: inconsistent write deadlineruntime: netpoll: eventfd ready for runtime: sudog with non-nil waitlinkruntime: mcall called on m->g0 stackfatal: recursive switchToCrashStack startm: P required for spinning=true) is not Grunnable or Gscanrunnable runtime: bad notifyList size - sync=signal arrived during cgo execution accessed data from freed user arena runtime: wrong goroutine in newstackruntime: invalid pc-encoded table f=timer moved between synctest bubblesexpected an ECDSA public key, got %Tunsupported SSLv2 handshake receivedtls: server did not send a key shareinvalid semicolon separator in querymalformed MIME header initial line: bytes: Repeat output length overflowjson: encoding error for type %q: %qECDSA sign expects *ecdsa.PrivateKey'none' signature type is not allowedRSA-PSS sign expects *rsa.PrivateKeystopCommsWorkers waiting for workerspingresp not received, disconnectingx509: zero or negative DSA parameterx509: invalid CRL distribution pointx509: invalid subject key identifierx509: malformed algorithm identifierOIDFromInts(%v) unexpected error: %vinvalid baggage list-member propertyinvalid pattern syntax (+ after -): crypto/rsa: missing private exponentcrypto/cipher: input not full blockscrypto/sha1: invalid hash state size%s sessionpresent: %t returncode: %dproxy: failed to parse port number: IA5String contains invalid characterECDSA P-256 SHA2-512 sign and verifyinvalid ChaCha8 Read buffer encodingchacha20: wrong HChaCha20 nonce sizeedwards25519: invalid point encodingcannot create context from nil parentunexpected CONTINUATION for stream %dbytes.Buffer: truncation out of rangehttp2: unencrypted HTTP/2 not enabledhttp2: Transport sending health checkhttp2: Transport health check successRoundTrip on uninitialized ClientConnhttp2: server encoding header %q = %qhttp: TLS handshake error from %s: %v2220446049250313080847263336181640625value too large for defined data typecannot exec a shared library directlyoperation not possible due to RF-killtimezone hour outside of range [0,23]IMUNIFY_PROXY_ZAP_SAMPLING_THEREAFTERMQTT publish timeout stage=%s type=%sError while reading response code: %vreflect: Bits of non-arithmetic Type reflect: NumField of non-struct type reflect: OverflowInt of non-int type reflect: funcLayout of non-func type reflect.Value.Bytes of non-byte slicereflect.Value.Bytes of non-byte arrayreflect.Value.Bytes of non-rune slicemethod ABI and value ABI do not alignreflect.Value.Convert: value of type each group must have 4 or less digitsruntime: allocation size out of range) is smaller than minimum page size (/cpu/classes/gc/mark/idle:cpu-secondssetprofilebucket: profile already setfailed to reserve page summary memory_cgo_notify_runtime_init_done missingfatal: concurrent switchToCrashStack startTheWorld: inconsistent mp->nextpruntime: unexpected SPWRITE function all goroutines are asleep - deadlock!semaphore wake of synctest goroutine too many Authorities to pack (>65535)too many Additionals to pack (>65535)godebug: unexpected IncNonDefault of crypto: Size of unknown hash functiontls: unsupported certificate key (%T)tls: failed to verify certificate: %sgzip.Write: non-Latin-1 header stringECDSA verify expects *ecdsa.PublicKeyRSA-PSS verify expects *rsa.PublicKeyConnect() called but not disconnectedstartIncomingComms goroutine completestartIncomingComms: got msg on iboundstartIncomingComms: received pingrespFailed to parse %q broker address: %sx509: malformed extension value fieldx509: RSA key missing NULL parametersx509: invalid CRL distribution points%d chains with incompatible key usagebisect.Hash: unexpected argument typecipher: message authentication failedcrypto/cipher: invalid buffer overlapcrypto/cipher: incorrect GCM tag sizechacha20poly1305: plaintext too largeout does not point to an integer typecrypto/ecdh: invalid private key sizeexplicitly tagged member didn't match(?i)^[[:space:]]*(unordered )?output:bigmod: internal error: shrinking natcrypto/rsa: unsupported hash functioncrypto/rsa: public exponent too largecannot set a key on a private use tagfailed to parse Location header %q: %vhttp2: server connection from %v on %phttp: Accept error: %v; retrying in %v1110223024625156540423631668090820312555511151231257827021181583404541015625strings: Repeat output length overflowcan not access a needed shared librarytime: missing Location in call to DateHTTP request: method=%s url=%s body=%sauth: %s rejected - invalid IAID tokenFile modification detected via pollingNotified systemd that service is readyreflect.typeptrdata: unexpected type, reflect: close of receive-only channelreflect: Method on nil interface valueIPv4 field has octet with leading zeroindex out of range [%x] with length %ym changed unexpectedly in cgocallbackgmakechan: invalid channel element typeunreachable method called. linker bug?gcBgMarkWorker: blackening not enabledcannot read stack of running goroutineruntime: blocked read on free polldescruntime: sudog with non-false isSelectarg size to reflect.call more than 1GBv could not fit in traceBytesPerNumberinsufficient data for base length typetls: invalid ServerKeyExchange messageexpected an Ed25519 public key, got %Tinternal error: unknown signature typetls: server selected unsupported grouptls: server selected unsupported curvetls: missing ServerKeyExchange messagetls: internal error: unsupported curvemime: expected slash after first tokenafter decimal point in numeric literalinternalConnLost unexpected status: %sstartIncomingComms: got msg from storex509: invalid subject alternative namex509: invalid authority key identifierx509: empty name constraints extensionx509: cannot validate certificate for arch-specific Castagnoli not availableconcurrent map iteration and map writeecdsa: public key does not match curvechacha20poly1305: ciphertext too largeConnection Refused: Server UnavailableConnection Refused: Protocol Violationinternal error: unknown string type %dasn1: Unmarshal recipient value is nilinvalid P224 compressed point encodinginvalid P256 compressed point encodinginvalid P384 compressed point encodinginvalid P521 compressed point encodingbigmod: internal error: bad arithmeticcrypto/sha256: invalid hash state sizeGODEBUG sys/cpu: unknown cpu feature "crypto/sha512: invalid hash state sizeno NT_GNU_BUILD_ID found in ELF binarystarting imunify-agent-proxy version %qhttp: putIdleConn: keep alives disabledusername/password authentication failed277555756156289135105907917022705078125transport endpoint is already connectedSetctty set but Ctty not valid in childsyscall.releaseForkLock: negative count2006-01-02 15:04:05.999999999 -0700 MSTfailed to connect to unix socket %s: %wFailed to watch secret directory %s: %v/etc/imunify-agent-proxy/jwt-secret.oldreflect: OverflowUint of non-uint type reflect.MakeMapWithSize of non-map typeIPv4 field must have at least one digitmismatched count during itab table copyout of memory allocating heap arena map/cpu/classes/gc/mark/assist:cpu-seconds/cpu/classes/scavenge/total:cpu-seconds/memory/classes/profiling/buckets:bytesmspan.sweep: bad span state after sweepruntime: blocked write on free polldescruntime.Pinner: object already unpinnedsuspendG from non-preemptible goroutineruntime: casfrom_Gscanstatus failed gp=stack growth not allowed in system calltraceback: unexpected SPWRITE function traceRegion: alloc with concurrent droptls: unsupported certificate curve (%s)tls: internal error: wrong nonce lengthchain is not signed by an acceptable CAinvalid indexed representation index %dbuild line missing '=' after quoted keymath/big: buffer too small to fit valueobound from incoming msg to write, typex509: invalid subject alternative namesx509: invalid NameConstraints extensionx509: failed to parse URI constraint %qx509: invalid policy mappings extension because it doesn't contain any IP SANstoo many list-members in baggage-stringecdsa: private key does not match curvecipher: incorrect tag size given to GCMcrypto/cipher: incorrect GCM nonce sizemissing argument to repetition operatortrailing backslash at end of expressionproxy: destination host name too long: tags don't match (%d vs %+v) %+v %s @%dasn1: Unmarshal recipient value is nil invalid GOAMD64: must be v1, v2, v3, v4exec: environment variable contains NULed25519: bad Ed25519ph context length: fips140: no verification checksum foundnegative minwidth, tabwidth, or paddingtime: Stop called on uninitialized Timererrors: target must be a non-nil pointerhttp2: timeout awaiting response headersFrame accessor called on non-owned Frameinternal error: expecting non-nil streamrequest header %q is not valid in HTTP/2http2: Transport encoding header %q = %qprotocol error: headers after END_STREAMwriteData(stream=%d, p=%d, endStream=%v)host contains '{' (missing initial '/'?)bad wildcard segment (must end with '}')13877787807814456755295395851135253906256938893903907228377647697925567626953125ryuFtoaFixed32 called with negative precaddress family not supported by protocolpermission denied for unix socket %s: %wPath validation required for command: %ssystem-account username is not permittedMQTT publish failed stage=%s type=%s: %vMapIter.Key called on exhausted iteratorreflect: FieldByName of non-struct type reflect.Value.Call: call of nil functionreflect.Value.Call: wrong argument countattempted to copy pointer to FP registerreflect.Value.SetBytes of non-byte slicereflect.Value.setRunes of non-rune sliceinvalid span in heapArena for user arenabulkBarrierPreWrite: unaligned argumentsruntime: typeBitsBulkBarrier with type refill of span with free space remaining/cpu/classes/scavenge/assist:cpu-secondsruntime.SetFinalizer: first argument is failed to acquire lock to reset capacitymarkWorkerStop: unknown mark worker modecannot free workbufs when work.full != 0runtime: out of memory: cannot allocate runtime: netpollBreak write failed with stopTheWorld: broken CPU time accountingglobal runq empty with non-zero runqsizemust be able to track idle limiter eventgoroutine stack size is not a power of 2oversized record received with length %dtls: received empty certificates messagemultipart: unexpected line in Next(): %qmalformed MIME header: missing colon: %qevictOldest(%v) on table with %v entriesEd25519 verify expects ed25519.PublicKeyports not allowed with file URLs: got %vusing custom onConnectAttempt handler...failed to connect to broker, trying nextTrying reconnect using MQTT 3.1 protocolBUG BUG BUG reconnection function is nilTrying to use memory store, but not openconnection lost before Publish completedstartIncomingComms: received suback, id:startIncomingComms: received puback, id:startIncomingComms: received pubrec, id:startIncomingComms: received pubrel, id:outgoing waiting for an outbound messageAsked to persist an invalid message typex509: malformed extension critical fieldx509: cannot parse IP address of length %s %q is not permitted by any constraintcrypto/rsa: input must be hashed messagecrypto/cipher: output smaller than inputcipher: the nonce can't have zero lengthcrypto/cipher: message too large for GCMchacha20poly1305: invalid buffer overlapquotedprintable: invalid hex byte 0x%02xConnection Refused: Bad Protocol Versionconcurrent write to websocket connectionNumericString contains invalid charactercannot represent time as GeneralizedTimeed25519: bad Ed25519ctx context length: rsa: internal error: inconsistent lengthmismatched scale ratios, got %d, want %dheap profile: %d: %d [%d: %d] @ heap/%d edwards25519: use of uninitialized PointwriteEndsStream called on nil writeFramerinvariant; can't close stream in state %vhttp2: server ignoring unknown setting %vWriteHeader called after Handler finishedhttp2: no cached connection was availablehttp2: Transport health check failure: %vhttp2: invalid Upgrade request header: %qtransport got GOAWAY with error code = %vunexpected call to os.Exit(0) during test34694469519536141888238489627838134765625strconv: illegal AppendInt/FormatInt baseclone(CLONE_PIDFD) failed to return pidfdtime: Reset called on uninitialized Timertime: missing Location in call to Time.InTime.UnmarshalBinary: unsupported versionfailed to read current secret from %s: %wEvent dropped due to BeforeSend callback.Event dropped due to noopTransport usage.can't call pointer on a non-pointer ValueMapIter.Next called on exhausted iteratorreflect.Value.Addr of unaddressable valuecolon must be followed by more characters closed, unable to open /dev/null, errno=runtime: typeBitsBulkBarrier without type/memory/classes/metadata/mspan/free:bytesruntime.SetFinalizer: second argument is gcSweep being done but phase is not GCoffobjects added out of order or overlappingmheap.freeSpanLocked - invalid stack freemheap.freeSpanLocked - invalid span stateattempted to add zero-sized address rangeruntime: blocked read on closing polldescstopTheWorld: not stopped (stopwait != 0) received on thread with no signal stack invalid timer: fake time but no syncgrouptls: internal error: unsupported key (%T)tls: handshake has not yet been performedinvalid value length: expected %d, got %dnet/url: invalid control character in URLbytes.Buffer.WriteTo: invalid Write countbytes.Reader.WriteTo: invalid Write countidna: internal error in punycode encodingunexpected character after quoted key: %qfsnotify: can't remove non-existent watchCONNACK was not CONN_ACCEPTED, but ratherDisconnect packet not sent due to timeoutConnect comms goroutine - error triggeredstartIncomingComms: received pubcomp, id:Asked to persist an invalid messages typex509: cannot parse URI %q: invalid domaincrypto/md5: invalid hash state identifierfips140: unknown GODEBUG setting fips140=A sampling of all past memory allocationsseconds and debug params are incompatiblewebsocket: duplicate header not allowed: asn1: internal error in parseTagAndLengthRSASSA-PKCS-v1.5 2048-bit sign and verifyGODEBUG sys/cpu: no value specified for "mix of request and response pseudo headersPRIORITY frame payload size was %d; want 5Failed to parse goroutine ID out of %q: %vhttp2: server connection error from %v: %vbad wildcard segment (must start with '{')http: multipart handled by MultipartReaderhttp: ContentLength=%d with Body length %d173472347597680709441192448139190673828125867361737988403547205962240695953369140625Time.MarshalBinary: unexpected zone offsetauth: %s rejected - no IAID token providedfailed to create directory for secrets: %wsync/atomic: store of nil value into ValueMapIter.Value called on exhausted iteratorreflect: negative length passed to ArrayOfreflect: Call with too few input argumentsmismatch between ABI description and typesreflect: cannot convert slice with length bytes; incompatible with mutex flag mask persistentalloc: align is not a power of 2out of memory allocating checkmarks bitmap/cpu/classes/gc/mark/dedicated:cpu-seconds/memory/classes/metadata/mcache/free:bytes/memory/classes/metadata/mspan/inuse:bytesnon-empty mark queue after concurrent marksweep: tried to preserve a user arena spanruntime: blocked write on closing polldescunexpected state passed to panicrangestateacquireSudog: found s.elem != nil in cachefatal error: cgo callback before cgo call on a locked thread with no template threadunexpected signal during runtime execution received but handler not on signal stack stop of synctest timer from outside bubbletraceInitReadCPU called with trace enabledtraceStopReadCPU called with trace enabledattempted to trace a bad status for a procinsufficient data for resource body lengthinternal error: call to runtimeSource.Seedlooking for beginning of object key stringexpected 3 columns for replacement; got %dcould not parse Go build info: line %d: %wthe requested hash function is unavailablecan't use /... with non-recursive watch %qTrying to close memory store, but not openTrying to reset memory store, but not openconnection lost before Subscribe completedstartIncomingComms: received unsuback, id:x509: %q cannot be encoded as an IA5Stringx509: RSA modulus is not a positive numberx509: invalid policy constraints extensionx509: invalid inhibit any policy extensioncrypto/rsa: salt length cannot be negativecrypto/sha1: invalid hash state identifierpoly1305: write to MAC after Sum or Verifyquotedprintable: invalid bytes after =: %q%s: dup: %t qos: %d retain: %t rLength: %d%s topicName: %s MessageID: %d payload: %swebsocket: invalid compression negotiationPrintableString contains invalid characterSentry integration initialized successfullyhttp2: client conn could not be establishedno multipart boundary param in Content-Typenet/http: timeout awaiting response headerstimeout waiting for SETTINGS frames from %vhttp2: server closing client connection: %vhttp2: unexpected ALPN protocol %q; want %qTransport: unhandled response frame type %TError enabling Transport HTTP/2 support: %vmult64bitPow10: power of 10 is out of rangeinterrupted system call should be restartedUser %s validation required for command: %sreflect: nil type passed to Type.ImplementsGcSlice can't handle on-demand gcdata typesmultiple Read calls return no data or errorreflect: CallSlice of non-variadic functionreflect: Call with too many input argumentsruntime: opened unexpected file descriptor /memory/classes/metadata/mcache/inuse:bytesruntime.SetFinalizer: first argument is nilruntime.SetFinalizer: finalizer already setgcBgMarkWorker: unexpected gcMarkWorkerModenon in-use span found with specials bit setgrew heap, but no adequate free space foundroot level max pages doesn't fit in summarymeasures of the retained heap are not equalruntime.Pinner: argument is not a pointer: runtime: releaseSudog with non-nil gp.paramunknown runnable goroutine during bootstrapruntime: casfrom_Gscanstatus bad oldval gp=runtime:stoplockedm: lockedg (atomicstatus=methodValueCallFrameObjs is not in a modulereset of synctest timer from outside bubblesynctest timer accessed from outside bubbletraceSnapshotMemory: tracing is not enabledtls: received unexpected key update messagetls: no supported elliptic curves for ECDHEtls: server did not select an ALPN protocoltls: server sent unrequested session tickettls: received malformed key_share extensiontls: invalid early data for QUIC connectionbufio: tried to rewind past start of bufferchunked encoding contains too much non-datareplacement with no module on previous linekeyfunc returned empty verification key setstatus is already connected or reconnectingoutgoing oboundFromIncoming reporting errorstartComms received empty incomingComms msgx509: failed to parse dnsName constraint %qerror unpacking publish, payload length < 0explicit time type given to non-time memberexec: WaitDelay expired before I/O completeimpl: package name must not contain slashesedwards25519: invalid point encoding lengthhttp: putIdleConn: too many idle connectionsconnection exceeded flow control window sizehttp2: could not negotiate protocol mutuallyhttp2: invalid Connection request header: %qhttp2: 1xx informational responses too largehttp: Request.ContentLength=%d with nil Bodymult128bitPow10: power of 10 is out of rangeThere was an issue with sending an event: %v using value obtained using unexported fieldreflect: call of MakeFunc with non-Func typereflect: funcLayout with interface receiver reflect: function created by MakeFunc using reflect: slice length out of range in SetLenspan on userArena.faultList has invalid sizesend on synctest channel from outside bubbleruntime: lfstack.push invalid packing: node=out of memory allocating heap arena metadataruntime: cannot remap pages in address space/cpu/classes/scavenge/background:cpu-secondsruntime: unexpected metric registration for gcmarknewobject called while doing checkmarkactive sweepers found at start of mark phaseno P available, write barriers are forbiddenheapInUse and consistent stats are not equaltotalFree and consistent stats are not equalmappedReady and other memstats are not equalcannot trace user goroutine on its own stacktraceStartReadCPU called with trace disabledunsafe.Slice: ptr is nil and len is not zeroinsufficient data for calculated length typetls: server's Finished message was incorrecttls: server sent an incorrect legacy versiontls: invalid server X25519MLKEM768 key sharetls: invalid X25519MLKEM768 server key shareencoding alphabet contains newline characterencoding alphabet includes duplicate symbolsmultipart: expecting a new Part; got line %qmime: unexpected content after media subtypetoken contains an invalid number of segments%v Logger.check error: failed to get caller fragments not allowed with file URLs: got %vstartCommsWorkers output redirector finishedstoring publish message (connecting), topic:connection lost before Unsubscribe completedstartIncomingComms: received publish, msgId:x509: invalid RDNSequence: invalid attributex509: internal error: cannot parse domain %qcrypto/x509: error fetching intermediate: %wcipher: NewGCM requires 128-bit block cipherStack traces of holders of contended mutexesrepeated read on failed websocket connectioninvalid GOMIPS: must be hardfloat, softfloated25519: bad Ed25519ph message hash length: crypto/sha256: invalid hash state identifiercrypto/sha512: invalid hash state identifiermismatch: sample has: %d values vs. %d typescontext: internal error: missing cancel errorhttp: putIdleConn: connection is in bad statehttp: no Client.Transport or DefaultTransportinvalid request :path %q from URL.Opaque = %qunbuffered done channel passed in for type %THTTP/1.1 %d %s%sUnsupported transfer encodingnet/http: internal error: connCount underflowhandleTransientAcquire called in invalid modehandleTransientRelease called in invalid modefinal release of handle without processStatuscannot send after transport endpoint shutdownsite_path resolves to a sensitive system pathWatching directory %s for secret file changesreflect: nil type passed to Type.AssignableToreflect: internal error: invalid method indextransitioning GC to the same state as before?produced a trigger greater than the heap goaltried to run scavenger from another goroutineruntime: failed mSpanList.remove span.npages=totalAlloc and consistent stats are not equalexitsyscall: syscall frame is no longer validunsafe.String: ptr is nil and len is not zeroparsing/packing of this section has completedtls: internal error: unexpected renegotiationbufio.Scanner: Read returned impossible countjson.RawMessage: UnmarshalJSON on nil pointersink factory already registered for scheme %qIgnored key-value pairs with non-string keys.resume exiting due to stop (ibound <- packet)startIncomingComms: inboundFromStore completeoutbound wrote disconnect, closing connectionx509: IP constraint contained invalid mask %xx509: certificate signed by unknown authoritycrypto/rsa: message too long for RSA key sizemath/big: cannot unmarshal %q into a *big.Inttransform: input and output are not identicalzero length explicit tag was not an asn1.Flaginvalid GORISCV64: must be rva20u64, rva22u64w must be at least 2 by the definition of NAFrequest Content-Type isn't multipart/form-dataGOAWAY close timer fired; closing conn from %vinternal error: cannot create stream with id 0http2: Transport creating client conn %p to %vprotocol error: received DATA after END_STREAMclient sent an HTTP request to an HTTPS servernet/http: internal error: misuse of tryDeliverhandlePersistentRelease called in invalid modeboth Setctty and Foreground set in SysProcAttrTime.UnmarshalJSON: input is not a JSON stringauth: %s not configured; %s is unauthenticatedSending %s failed with the following error: %sToo many requests for %q, backing off till: %vUsing release from environment variable %s: %sreflect: nil type passed to Type.ConvertibleToreflect.Struct: fields with different PkgPath reflect.StructOf: illegal embedded field type returned value obtained from unexported fieldreflect.Value.Slice: slice index out of boundsslice bounds out of range [:%x] with length %ypanicwrap: unexpected string after type name: memory reservation exceeds address space limittried to park scavenger from another goroutinereleased less than one physical page of memorysysGrow bounds not aligned to pallocChunkBytesruntime: failed to create new OS thread (have runtime: panic before malloc heap initialized stopTheWorld: not stopped (status != _Pgcstop)select on synctest channel from outside bubbleruntime: name offset base pointer out of rangeruntime: type offset base pointer out of rangeruntime: text offset base pointer out of rangePSSWithSHA256PSSWithSHA384PSSWithSHA512Ed25519tls: server chose an unconfigured cipher suitetls: failed to parse certificate from server: tls: server did not echo the legacy session IDtls: server accepted 0-RTT with the wrong ALPNtls: received new session ticket from a clientfirst path segment in URL cannot contain colonbytes.Reader.UnreadByte: at beginning of slice'none' signing method with non-empty signaturecan't register a sink factory for empty stringstoring publish message (reconnecting), topic:invalid message type (%T) in store (discarded)%v Unsafe CheckedEntry re-use near Entry %+v. x509: failed to unmarshal elliptic curve pointx509: failed to parse rfc822Name constraint %qx509: malformed signature algorithm identifierinvariant failed: growthLeft is unexpectedly 0math/big: mismatched montgomery number lengthsConnection Refused: Client Identifier RejectedHTTP/1.1 204 No Content Connection: close invalid GOMIPS64: must be hardfloat, softfloated25519: internal error: setting scalar failededwards25519: invalid field element input sizelanguage: subtag %q is well-formed but unknownServer error: %v. Initiating graceful shutdown.http: server gave HTTP response to HTTPS clientflow control update exceeds maximum window sizewr.done != nil for write100ContinueHeadersFrame1xx informational response with END_STREAM flagprotocol error: received DATA on a HEAD request[FrameWriteRequest stream=%d, ch=%v, writer=%v]unexpected error wrapping poll.ErrFileClosing: attempting to link in too many shared librariesreflect.Value.Bytes of unaddressable byte arrayreflect: CallSlice with too few input argumentsregister-based return value has stack componentslice bounds out of range [::%x] with length %yreceive on synctest channel from outside bubbleruntime lock: sleeping while lock is availableP has cached GC work at end of mark terminationfailed to acquire lock to start a GC transitionfinishGCTransition called without starting one?tried to sleep scavenger from another goroutineheapReleased and consistent stats are not equalracy sudog adjustment due to parking on channelfunction symbol table not sorted by PC offset: attempted to trace a bad status for a goroutinefirst record does not look like a TLS handshaketls: handshake did not verify certificate chaintls: incorrect renegotiation extension contentstls: server selected unadvertised ALPN protocoltls: internal error: pskBinders length mismatchtls: server selected TLS 1.3 in a renegotiationtls: malformed encrypted client hello extensiontls: server sent two HelloRetryRequest messagesbufio: reader returned negative count from Readchi: invalid regexp pattern '%s' in route paramstoring publish message (disconnecting), topic:x509: malformed public key algorithm identifierx509: internal error: IP SAN %x failed to parse^([\x21\x23-\x2b\x2d-\x3a\x3c-\x5B\x5D-\x7e]*)$chacha20poly1305: message authentication failedcrypto/ecdh: public key is the identity element
  • %s:
    %s
    • asn1: Unmarshal recipient value is non-pointer explicit string type given to non-string memberGOEXPERIMENT regabiargs requires regabiwrappersbigmod: modulus for ExpShortVarTime must be oddinvalid file descriptor %d for socket activationnet/http: extended connect not supported by peerinternal error: should have a body in this statestrconv: illegal AppendFloat/FormatFloat bitSizenot enough significant bits after mult64bitPow10reflect: CallSlice with too many input argumentsslice bounds out of range [:%x] with capacity %yruntime: cannot map pages in arena address spaceruntime: malformed profBuf buffer - invalid sizeattempt to trace invalid or unsupported P statusparsing/packing of this type isn't available yettls: CloseWrite called before handshake completefailed to parse certificate #%d in the chain: %wtls: no FIPS compatible certificate chains foundtls: no supported symmetric ciphersuites for ECHtls: CurvePreferences includes unsupported curvebufio: writer returned negative count from Writechi: routing pattern must begin with '/' in '%s'could not convert json number value to float: %wx509: X25519 key encoded with illegal parametersx509: SAN uniformResourceIdentifier is malformedx509: IP constraint contained value of length %dx509: internal error: cannot parse constraint %qx509: internal error: URI SAN %q failed to parseout points to big.Int, but defaultValue does notproxy: failed to read port from SOCKS5 proxy at invalid GOPPC64: must be power8, power9, power10crypto/rsa: input must be hashed with given hashSignal %v received. Initiating graceful shutdown.http2: request body closed due to handler exitinghttp: wrote more than the declared Content-Length (Client.Timeout exceeded while awaiting headers)net/http: Transport.Dial hook returned (nil, nil)not enough significant bits after mult128bitPow10strings.Reader.UnreadByte: at beginning of stringstrings.Reader.WriteTo: invalid WriteString countinvalid or incomplete multibyte or wide character/var/run/defence360agent/non_root_simple_rpc.sockEvent dropped due to transport buffer being full.reflect.Value.Slice: slice of unaddressable arraythe :: must expand to at least one field of zerosslice bounds out of range [::%x] with capacity %yinvalid memory address or nil pointer dereferencepanicwrap: unexpected string after package name: s.allocCount != s.nelems && freeIndex == s.nelemsruntime.reflect_makemap: unsupported map key typesweeper left outstanding across sweep generationsfully empty unfreed span set block found in resetcasgstatus: waiting for Gwaiting but is Grunnablecrypto/tls: ExportKeyingMaterial context too longtls: server advertised unrequested ALPN extensiontls: server sent a cookie in a normal ServerHellochi: route param closing delimiter '}' is missingfailure whilst reporting completion of disconnect/etc/pki/ca-trust/extracted/pem/tls-ca-bundle.pemx509: invalid RDNSequence: invalid attribute typex509: Ed25519 key encoded with illegal parametersecdsa: internal error: truncated hash is too longcrypto/elliptic: internal error: invalid encodingchacha20poly1305: bad nonce length passed to Sealchacha20poly1305: bad nonce length passed to Openinternal error: fillWindow called with stale data%d    %s crypto/rsa: public exponent too small or negativefailed to create file listener from fd %d (%s): %wgo package net: dynamic selection of DNS resolver net/http: cannot rewind body after connection losshttp: putIdleConn: CloseIdleConnections was calledgot CONTINUATION for stream %d; expected stream %dhttp: suspiciously long trailer after chunked bodynet/http: Transport failed to read from server: %vnet/http: HTTP/1.x transport connection broken: %wSite search %s validation required for command: %sMQTT initial connect timeout (will auto-reconnect)cgo argument has Go pointer to unpinned Go pointermallocgc called with gcphase == _GCmarkterminationruntime.Pinner: object was allocated into an arenaruntime.Pinner: decreased non-existing pin counterrecursive call during initialization - linker skewattempt to execute system stack code on user stackcryptobyte: attempted write while child is pendingtls: received unexpected CertificateStatus messagetls: invalid signature by the server certificate: x509: missing ASN.1 contents; use ParseCertificatex509: invalid RDNSequence: invalid attribute valuex509: RSA public exponent is not a positive numbercrypto/elliptic: nistec rejected normalized scalarcrypto/rsa: prime factors are not relatively primecrypto/cipher: incorrect nonce length given to GCMchacha20: SetCounter attempted to rollback countercrypto/ecdh: public key does not match private keyThe command line invocation of the current programedwards25519: invalid SetUniformBytes input lengthhttp2: invalid Transfer-Encoding request header: %qprotocol error: received %T before a SETTINGS framehttp: Transport does not support unencrypted HTTP/2Ignoring event during startup grace period: %s (%s)^([[:xdigit:]]{32})-([[:xdigit:]]{16})(?:-([01]))?$limiterEvent.stop: invalid limiter event type foundpotentially overlapping in-use allocations detectedfatal: systemstack called from unexpected goroutinegodebug: Value of name not listed in godebugs.All: tls: VerifyHostname called on TLS server connectioncrypto/tls: reserved ExportKeyingMaterial label: %stls: server's identity changed during renegotiationtls: server selected unsupported compression formattls: server sent an unexpected early_data extensionJSON decoder out of sync - data changing underfoot?query parameters not allowed with file URLs: got %vx509: certificate has expired or is not yet valid: crypto/elliptic: Add was called on an invalid pointproxy: failed to write greeting to SOCKS5 proxy at proxy: failed to read address from SOCKS5 proxy at ecdsa: internal error: request size exceeds maximumcrypto/ecdh: internal error: isLess input too largeerrors: *target must be interface or implement errorrequest header "TE" may only be "trailers" in HTTP/2http2: Transport readFrame error on conn %p: (%T) %vprotocol error: received DATA before a HEADERS frameruntime: cannot disable permissions in address spaceruntime.SetFinalizer: pointer not in allocated blockruntime: use of FixAlloc_Alloc before FixAlloc_Init span set block with unpopped elements found in resetcasfrom_Gscanstatus: gp->status is not in scan statetls: server selected unsupported protocol version %xtls: received a session ticket with invalid lifetimeuser and password not allowed with file URLs: got %vinternalConnLost stopDone unexpectedly nil - BUG BUGmatchAndDispatch order=false copy goroutine exiting.x509: cannot verify signature: insecure algorithm %vecdsa: internal error: unexpectedly masking off bitswebsocket: internal error, extra used in client modeproxy: failed to read greeting from SOCKS5 proxy at http: putIdleConn: too many idle connections for hosthttp2: Framer %p: failed to decode just-written frameillegal use of AllowIllegalReads with ReadMetaHeadershttp2: Transport failed to get client conn for %s: %vnon-CONNECT pattern with unclean path can never matchdescribeConflict called with non-conflicting patternsMQTT initial connect failed: %v (will auto-reconnect)Systemd notification not sent (NOTIFY_SOCKET not set)reflect: non-interface type passed to Type.Implementsreflect.Value.Slice: string slice index out of boundsnon-concurrent sweep failed to drain all sweep queuesexited a goroutine internally locked to the OS threadtls: received unexpected handshake message of type %Ttls: unexpected server_name extension in server hellobufio.Scan: too many empty tokens without progressingWebsocket handshake failure. StatusCode: %d. Body: %sx509: certificate specifies an incompatible key usagesmall map with no empty slot (concurrent map writes?)crypto/elliptic: attempted operation on invalid pointchacha20: internal error: wrong dst and/or src lengthcrypto/ecdh: internal error: mismatched isLess inputsExiting with status code %d due to errors encountered.http: Request.Write on Request with no Host or URL setread loop ending; caller owns writable underlying conninternal error: expected to be already writing a framehttp2: received GOAWAY %+v, starting graceful shutdownhttp2: handler wrote more than declared Content-Lengthhttp2: invalid :protocol header in non-CONNECT requestnet/http: can't write control character in Request.URLCommand not in allowlist: user=%s attempted command=%sFailed initial secret load: %v, it might not exist yetEvent dropped by one of the Scope EventProcessors: %s runtime.m memory alignment too small for spinbit mutexmin size of malloc header is not a size class boundarygcControllerState.findRunnable: blackening not enabledcasGToWaitingForGC with non-isWaitingForGC wait reasonno goroutines (main called runtime.Goexit) - deadlock!trace: non-empty full trace buffer for done generationtrace: non-empty full trace buffer for next generation goroutine running on other thread; stack unavailable name is not in canonical format (it must end with a .)cryptobyte: Builder is exceeding its fixed-size buffertls: server resumed a session with a different versiontls: server accepted 0-RTT with the wrong cipher suitetls: certificate used with invalid signature algorithmbytes.Buffer: reader returned negative count from Readdisconnect called whist connection attempt in progressx509: cannot verify signature: algorithm unimplementedx509: invalid RDNSequence: invalid attribute value: %sURI with IP (%q) cannot be matched against constraints%s resolves to executable in current directory (.%c%s)quotedprintable: invalid unescaped byte 0x%02x in bodypanic calling String method on zero %v for flag %s: %vnet/http: request canceled while waiting for connectionnet/http: invalid byte %q in %s; dropping invalid byteshttp2: server: error reading preface from client %v: %vinternal error: can only be writing one frame at a timehttp2: Transport received GOAWAY from server ErrCode:%vFailed to create file watcher, will rely on polling: %vEvent dropped by one of the Client EventProcessors: %s Event dropped by one of the Global EventProcessors: %s reflect: internal error: invalid use of makeMethodValuereflect.FuncOf: last arg of variadic func must be sliceeach colon-separated field must have at least one digitmheap.freeSpanLocked - invalid free of user arena chunkcasfrom_Gscanstatus:top gp->status is not in scan statetls: internal error: handshake should have had a resultbufio.Scanner: SplitFunc returns negative advance countx509: authority info access incorrectly marked criticalx509: too many intermediates for path length constraintx509: failed to load system roots and no roots providedecdsa: internal error: shift can only be by 1 to 7 bitscipher.NewCBCEncrypter: IV length must equal block sizecipher.NewCBCDecrypter: IV length must equal block sizeStack traces that led to the creation of new OS threadsproxy: no support for SOCKS5 proxy connections of type language: different values for same key in -u extensionedwards25519: invalid SetBytesWithClamping input lengthhttp2: request body larger than specified content lengthhttp2: response header list larger than advertised limithttp: Request.RequestURI can't be set in client requestsstrings: illegal use of non-zero Builder copied by valuenet/http: Transport.DialContext hook returned (nil, nil)panic recovered in handler: method=%s url=%s panic=%v %sSecretManager initialized with runtime reload capabilitynon-empty pointer map passed for non-pointer-size valuesrange function continued iteration after loop body panicrange function continued iteration after whole loop exitprofilealloc called without a P or outside bootstrappingin gcMark expecting to see gcphase as _GCmarkterminationruntime: netpoll: eventfd ready for something unexpectedsemaphore wake of synctest goroutine from outside bubbleptrEncoder.encode should have emptied ptrSeen via defersfile URLs must leave host empty or use localhost: got %vinvalid message type (inbound - %T) in store (discarded)x509: subject key identifier incorrectly marked criticalx509: internal error: empty chain when appending CA certb4050a850c04b3abf54132565044b0b7d7bfd8ba270b39432355ffb4b70e0cbd6bb4bf7f321390b94a03c1d356c21122343280d6115c1d21bd376388b5f723fb4c22dfe6cd4375a05a07476444d5819985007e34crypto/cipher: internal error: generic CBC used with AESinvalid value for "seconds" - must be a positive integerhttp2: TLS conn unexpectedly found in unencrypted handoffnon-canonical case for reserved param key: got=%q want=%qsync: WaitGroup misuse: Add called concurrently with Waitruntime: checkmarks found unexpected unmarked object obj=runtime: failed to disable profiling timer; timer_delete(non-Go code set up signal handler without SA_ONSTACK flagtls: Ed25519 public keys are not supported before TLS 1.2received record with version %x when expecting version %xtls: server sent an unnecessary HelloRetryRequest messagetls: server selected an invalid PSK and cipher suite pairConnect comms goroutine - error triggered during send Pubcrypto/cipher: invalid buffer overlap of output and inputcrypto/drbg: internal error: request size exceeds maximumproxy: failed to read connect reply from SOCKS5 proxy at proxy: failed to read domain length from SOCKS5 proxy at cannot run executable found relative to current directory (set GODEBUG=execwait=2 to capture stacks for debugging)http2: client connection force closed via ClientConn.CloseTransaction dropped due to BeforeSendTransaction callback.tls: server changed cipher suite after a HelloRetryRequestjson: cannot set embedded pointer to unexported struct: %vstatus can only transition to connecting from disconnectedx509: authority key identifier incorrectly marked criticalx509: certificate contains duplicate extension with OID %qcrypto/elliptic: ScalarMult was called on an invalid pointcrypto/ecdh: bad X25519 remote ECDH input: low order point"seconds" parameter is not supported for this profile typeConnection Refused: Username or Password in unknown formatproxy: failed to write connect request to SOCKS5 proxy at GODEBUG=execwait=2 detected a leaked exec.Cmd created by: http2: Transport received Server's graceful shutdown GOAWAYRoundTripper returned a response & error; ignoring responsehttp: superfluous response.WriteHeader call from %s (%s:%d)http: response.Write on hijacked connection from %s (%s:%d)chi: all middlewares must be defined before routes on a muxsync: WaitGroup is reused before previous Wait has returnedsync/atomic: store of inconsistently typed value into Valuereflect: reflect.Value.Elem on an invalid notinheap pointerreflect: indirection through nil pointer to embedded structruntime: mmap: too much locked memory (check 'ulimit -l'). tried to trace goroutine with invalid or unsupported statustls: server resumed a session with a different cipher suitetls: server selected TLS 1.3 using the legacy version fieldtls: server sent an unnecessary HelloRetryRequest key_sharebufio.Scanner: SplitFunc returns advance count beyond inputDetect continual connection lost after reconnect, slept forbreadcrumb level must be lower than or equal to error levelecdsa: internal error: ordInverse produced an invalid valuecrypto/rc4: use of RC4 is not allowed in FIPS 140-only modecrypto/ecdh: private key and public key curves do not matchcrypto/md5: use of MD5 is not allowed in FIPS 140-only mode (Client.Timeout or context cancellation while reading body)internal error: attempt to send frame on a closed stream: %vmalformed response from server: missing status pseudo headernet/http: server response headers exceeded %d bytes; abortedSentry sentry_version=%s, sentry_client=%s/%s, sentry_key=%scalled CompareAndDelete when value is not of comparable typereflect: call of reflect.Value.Len on ptr to non-array Valuemanual span allocation called with non-manually-managed typeaddr range base and limit are not in the same memory segmentruntime: failed to configure profiling timer; timer_settime(runtime: malformed profBuf buffer - tag and data out of synctls: no supported versions satisfy MinVersion and MaxVersiontls: initial handshake had non-empty renegotiation extensiontls: server resumed a session with a different EMS extensionchi: routing pattern '%s' contains duplicate param key, '%s'net/http: invalid Cookie.Domain %q; dropping domain attributeHTTP response: method=%s url=%s status=%d duration=%s body=%sreflect: wrong return count from function created by MakeFuncruntime: may need to increase max user processes (ulimit -u) tls: unsupported certificate: private key is %T, expected *%Ttls: EncryptedClientHelloConfigList contains no valid configstls: server sent a ServerHello extension forbidden in TLS 1.3disconnection was requested whilst the action was in progressx509: failed to parse URI constraint %q: cannot be IP addressexec: Cmd started a Process but leaked without a call to Waithttp2: request header list larger than peer's advertised limittrying to put back buffer of the wrong size in the copyBufPoolreflect.ArrayOf: array size would exceed virtual address spacereflect: reflect.Value.Pointer on an invalid notinheap pointerfound bad pointer in Go heap (incorrect use of unsafe or cgo?)limiterEvent.stop: found wrong event in p's limiter event slotslice length too short to convert to array or pointer to arrayruntime: internal error: misuse of lockOSThread/unlockOSThreadtls: server did not send a quic_transport_parameters extensionx509: certificate is not authorized to sign other certificatesURI with empty host (%q) cannot be matched against constraintscrypto/sha1: use of SHA-1 is not allowed in FIPS 140-only mode0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZwebsocket: internal error, unexpected text or binary in Readergo package net: GODEBUG setting forcing use of the Go resolver http2: push would exceed peer's SETTINGS_MAX_CONCURRENT_STREAMSrequest declared a Content-Length of %d but only wrote %d bytes

    HTTP Error 431

    Request Header Field(s) Too Large

    internal error: exactly one of res or err should be set; nil=%vMQTT publish waiter cap reached, skipping wait stage=%s type=%sinternal/sync.HashTrieMap: ran out of hash bits while iteratinginternal/sync.HashTrieMap: ran out of hash bits while insertingmalformed GOMEMLIMIT; see `go doc runtime/debug.SetMemoryLimit`tls: unexpected encrypted client hello extension in serverHellocrypto/ecdh: use of X25519 is not allowed in FIPS 140-only modecryptobyte: BuilderContinuation reallocated a fixed-size buffercrypto/ecdh: internal error: public key is the identity elementStack traces that led to blocking on synchronization primitivesgo package net: GODEBUG setting forcing use of the cgo resolver http: request method or response status code does not allow bodyhttp2: too many control frames in send queue, closing connection Content-Type: text/plain; charset=utf-8 Connection: close 0000000000000000000000000000000000000000000000000000000000000000 User impersonation attempt: user=%s tried to impersonate user=%sFailed to read old secret from %s, using current secret only: %vMQTT reconnecting, credentials refreshed (iaid=%s, token_len=%d)reflect.StructOf: struct size would exceed virtual address spaceruntime.SetFinalizer: first argument was allocated into an arenaattempted to trace stack of a goroutine this thread does not ownABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789-_json: invalid number literal, trying to unmarshal %q into NumberConnect() called but connection established in another goroutine5ac635d8aa3a93e7b3ebbd55769886bc651d06b0cc53b0f63bce3c3e27d2604b6b17d1f2e12c4247f8bce6e563a440f277037d812deb33a0f4a13945d898c2964fe342e2fe1a7f9b8ee7eb4a7c0f9e162bce33576b315ececbb6406837bf51f5flate: invalid compression level %d: want value in range [-2, 9]proxy: failed to read authentication reply from SOCKS5 proxy at http: response.WriteHeader on hijacked connection from %s (%s:%d)net/http: Transport.DialTLS or DialTLSContext returned (nil, nil)reflect: StructOf does not support methods of embedded interfacesuser arena chunk size is not a multiple of the physical page sizeruntime: function marked with #cgo nocallback called back into Goruntime.SetFinalizer: pointer not at beginning of allocated blocktls: internal error: attempted to read record with QUIC transporttls: server selected an invalid version after a HelloRetryRequestx509: policy constraints inhibitPolicyMapping field overflows intx509: inner and outer signature algorithm identifiers don't matchx509: issuer name does not match subject from issuing certificatecrypto/des: use of TripleDES is not allowed in FIPS 140-only modecryptobyte: pending child length %d exceeds %d-byte length prefixproxy: failed to write authentication request to SOCKS5 proxy at nistec: internal error: p224Table called with out-of-bounds valuenistec: internal error: p384Table called with out-of-bounds valuenistec: internal error: p521Table called with out-of-bounds valuesender tried to send more than declared Content-Length of %d bytesruntime: unexpected error while checking standard file descriptor runtime: ReadTrace called from multiple goroutines simultaneously tls: certificate private key (%T) does not implement crypto.Signertls: server sent an unexpected quic_transport_parameters extensionstartCommsWorkers called when commsworkers already running BUG BUGx509: policy constraints requireExplicitPolicy field overflows intx509: certificate is not valid for any names, but wanted to match cryptobyte: high-tag number identifier octects not supported: 0x%xwebsocket: internal error, unexpected bytes at end of flate streamtls: server sent certificate containing RSA key larger than %d bitscrypto/cipher: invalid buffer overlap of output and additional datapadding bytes must all be zeros unless AllowIllegalWrites is enabledhttp2: Transport conn %p received error from processing frame %v: %vhttp2: Transport received unsolicited DATA frame; closing connectionhttp: message cannot contain multiple Content-Length headers; got %qreflect: reflect.Value.UnsafePointer on an invalid notinheap pointerembedded IPv4 address must replace the final 2 fields of the addressAllThreadsSyscall6 results differ between threads; runtime corruptedtls: internal error: sending non-handshake message to QUIC transportcrypto/hmac: hash generation function does not produce unique valuesconnection status is disconnecting so loss of connection is expectedinternalConnLost failed to set status to disconnected (stopDone): %s2695994666715063979466701508701963067355791626002630814351006629888126959946667150639794667015087019625940457807714424391721682722368061crypto/rsa: only crypto/rand.Reader is allowed in FIPS 140-only modehttp2: Transport closing idle conn %p (forSingleUse=%v, maxStream=%v)%s matches more methods than %s, but has a more specific path pattern%s matches fewer methods than %s, but has a more general path patternreflect: embedded interface with unexported method(s) not implementedtoo many hex fields to fit an embedded IPv4 at the end of the addressruntime.Pinner: found leaking pinned pointer; forgot to call Unpin()?tls: peer doesn't support the certificate custom signature algorithmstls: handshake message of length %d bytes exceeds maximum of %d bytesno-cache, no-store, no-transform, must-revalidate, private, max-age=0crypto/ecdh: only crypto/rand.Reader is allowed in FIPS 140-only modeedwards25519: internal error: setShortBytes called with a long stringgot %s for stream %d; expected CONTINUATION following %s for stream %dbytes.Buffer: UnreadByte: previous operation was not a successful readx509: certificate relies on legacy Common Name field, use SANs insteadcrypto/ecdsa: only crypto/rand.Reader is allowed in FIPS 140-only modecrypto/ed25519: use of Ed25519ctx is not allowed in FIPS 140-only modeinternal error: attempt to send frame on a half-closed-local stream: %vhttps://e21ff18c071a9f4f5427a2b4b5415c9e@im360.sentry.cloudlinux.com/38range function recovered a loop body panic and did not resume panickingtoo many concurrent operations on a single file or socket (max 1048575)tls: peer doesn't support any of the certificate's signature algorithmsdynamic table size update MUST occur at the beginning of a header blockjson: invalid use of ,string struct tag, trying to unmarshal %q into %vx509: issuer has name constraints but leaf doesn't have a SAN extension^([\x21\x23-\x27\x2A\x2B\x2D\x2E\x30-\x39\x41-\x5a\x5e-\x7a\x7c\x7e]+)$crypto/ecdsa: use of custom curves is not allowed in FIPS 140-only modeinvalid GOFIPS140: must be off, latest, inprocess, certified, or vX.Y.Zexec: command with a non-nil Cancel was not created with CommandContextreflect: embedded type with methods not implemented for non-pointer typeruntime.Goexit called in a thread that was not created by the Go runtimetls: server's certificate contains an unsupported type of public key: %Tcrypto/rsa: use of multi-prime keys is not allowed in FIPS 140-only modego package net: GODEBUG=netdns contains an invalid dns mode, ignoring it tls: received unexpected handshake message of type %T when waiting for %Ttls: internal error: handshake returned an error but is marked successfulmalformed response from server: malformed non-numeric status pseudo headernet/http: server replied with more than declared Content-Length; truncatedFailed to ensure log directory existance (continuing without logfile): %v runtime: cannot set cpu profile rate until previous profile has finished. tls: certificate RSA key size too small for supported signature algorithmscrypto/rand: failed to read random data (see https://go.dev/issue/66821): crypto/rsa: use of keys with odd size is not allowed in FIPS 140-only modegcm: internal error: using generic implementation despite hardware supportpermessage-deflate; server_no_context_takeover; client_no_context_takeoverUnsolicited response received on idle HTTP channel starting with %q; err=%vInvalid characters in user param: user=%s attempted with invalid user paramtls: internal error: attempted to read record with pending application dataClient moved to disconnected state while reconnecting, abandoning reconnectHTTP/1.0 400 Bad Request Client sent an HTTP request to an HTTPS server. tls: failed to send closeNotify alert (but connection was closed anyway): %wtls: server certificate contains incorrect key type for selected ciphersuitecrypto/rsa: use of even public exponent is not allowed in FIPS 140-only modeinvalid Body.Read call. After hijacked, the original Request must not be usedMapIter.Next called on an iterator that does not have an associated map Valuecrypto/tls: ExportKeyingMaterial is unavailable when renegotiation is enabledpattern %q (registered at %s) conflicts with pattern %q (registered at %s): %sreflect: embedded type with methods not implemented if type is not first fieldrange function continued iteration after function for loop body returned falsex509: signature check attempts limit reached while verifying certificate chain115792089210356248762697446949407573530086143415290314195533631308867097853951115792089210356248762697446949407573529996955224135760342422259061068512044369crypto/rsa: use of PKCS#1 v1.5 encryption is not allowed in FIPS 140-only modehttp2: server closing client connection; error reading frame from client %s: %vcannot convert slice with length %y to array or pointer to array with length %xtls: client certificate private key of type %T does not implement crypto.Signerhttp: RoundTripper implementation (%T) returned a nil *Response with a nil errorbug: unexpected way for two patterns %s and %s to conflict: methods %s, paths %sPath validation failed: user=%s attempted to access path=%s outside site_path=%stls: either ServerName or InsecureSkipVerify must be specified in the tls.Configchi: wildcard '*' must be the last pattern in a route, otherwise use a '{param}'matchAndDispatch received acknowledgment after processing stopped (ACK dropped).x509: invalid signature: parent certificate cannot sign this kind of certificatecrypto/ecdh: internal error: nistec ScalarBaseMult failed for a fixed-size inputcrypto/rand: blocked for 60 seconds waiting to read random data from the kernel (bad use of unsafe.Pointer or having race conditions? try -d=checkptr or -race) crypto/rsa: use of public exponent <= 2 is not allowed in FIPS 140-only modecrypto/rsa: use of primes of different sizes is not allowed in FIPS 140-only modecrypto/aes: internal error: using generic implementation despite hardware supportThe Modules integration is not available in binaries built without module support.refusing to use HTTP_PROXY value in CGI environment; see golang.org/s/cgihttpproxyx509: a root or intermediate certificate is not authorized to sign for this name: reflect: embedded type with methods not implemented if there is more than one fieldexpected all size classes up to min size for malloc header to fit in one-page spansjson: invalid use of ,string struct tag, trying to unmarshal unquoted value into %vx509: issuer has name constraints but leaf contains unknown or unconstrained name: (possibly because of %q while trying to verify candidate authority certificate %q)crypto/rsa: use of keys smaller than 2048 bits is not allowed in FIPS 140-only modecrypto/cipher: use of CBC with non-AES ciphers is not allowed in FIPS 140-only modecrypto/cipher: use of GCM with non-AES ciphers is not allowed in FIPS 140-only modecrypto/hmac: use of keys shorter than 112 bits is not allowed in FIPS 140-only modetls: downgrade attempt detected, possibly due to a MitM attack or a broken middleboxx509: signature algorithm specifies an %s public key, but have public key of type %Tinvalid GOARM: must start with 5, 6, or 7, and may optionally end in either %q or %qstack too short to match cached location; stk = %#x, l.pcs = %#x, original stk = %#xhttp: WriteHeader called with both Transfer-Encoding of %q and a Content-Length of %dreflect.Value.Interface: cannot return value obtained from unexported field or methodcrypto/rsa: use of PSS salt longer than the hash is not allowed in FIPS 140-only modereflect: New of type that may not be allocated in heap (possibly undefined cgo C type)tls: MinVersion must be >= VersionTLS13 if EncryptedClientHelloConfigList is populatedtls: MaxVersion must be >= VersionTLS13 if EncryptedClientHelloConfigList is populatedx509: a root or intermediate certificate is not authorized for an extended key usage: Some Sentry features will not be available. See https://docs.sentry.io/product/releases/.http2: server sent GOAWAY and closed the connection; LastStreamID=%v, ErrCode=%v, debug=%qtls: unexpected encrypted client hello extension in server hello despite ECH being acceptedtls: server sent encrypted client hello retry configs after accepting encrypted client hellotls: handshake hash for a client certificate requested after discarding the handshake bufferinvalid GOARM64: must start with v8.{0-9} or v9.{0-5} and may optionally end in %q and/or %qtls: unsupported certificate: private key is *ed25519.PrivateKey, expected ed25519.PrivateKeycrypto/rsa: %d-bit keys are insecure (see https://go.dev/pkg/crypto/rsa#hdr-Minimum_key_size)Sentry client initialized with an empty DSN. Using noopTransport. No events will be delivered.b3312fa7e23ee7e4988e056be3f82d19181d9c6efe8141120314088f5013875ac656398d8a2ed19d2a85c8edd3ec2aefaa87ca22be8b05378eb1c71ef320ad746e1d3b628ba79b9859f741e082542a385502f25dbf55296c3a545e3872760ab73617de4a96262c6f5d9e98bf9292dc29f8f41dbd289a147ce9da3113b5f0b8c00a60b1ce1d7e819d7a431d7c90ea0e5fcrypto/rsa: use of hash functions other than SHA-2 or SHA-3 is not allowed in FIPS 140-only modehttp: RoundTripper implementation (%T) returned a *Response with content length %d but a nil BodyEvent dropped due to being matched by `IgnoreErrors` option.| Value matched: %s | Filter used: %smatchAndDispatch received message and no handler was available. Message will NOT be acknowledged.crypto/hmac: use of hash functions other than SHA-2 or SHA-3 is not allowed in FIPS 140-only modeNoClientCertRequestClientCertRequireAnyClientCertVerifyClientCertIfGivenRequireAndVerifyClientCertchi: wildcard '*' must be the last value in a route. trim trailing text or use a '{param}' insteaded25519: expected opts.Hash zero (unhashed message, for standard Ed25519) or SHA-512 (for Ed25519ph)cgocheck > 1 mode is no longer supported at runtime. Use GOEXPERIMENT=cgocheck2 at build time instead.xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posixHTTP/1.1 400 Bad Request Content-Type: text/plain; charset=utf-8 Connection: close 400 Bad Request full goroutine stack dump
    Profile Descriptions: